BLASTX nr result
ID: Phellodendron21_contig00000498
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Phellodendron21_contig00000498 (362 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006443732.1 hypothetical protein CICLE_v10020687mg [Citrus cl... 90 8e-19 >XP_006443732.1 hypothetical protein CICLE_v10020687mg [Citrus clementina] XP_006443733.1 hypothetical protein CICLE_v10020687mg [Citrus clementina] XP_006443734.1 hypothetical protein CICLE_v10020687mg [Citrus clementina] XP_006479439.1 PREDICTED: uncharacterized protein LOC102613459 [Citrus sinensis] XP_006479440.1 PREDICTED: uncharacterized protein LOC102613459 [Citrus sinensis] ESR56972.1 hypothetical protein CICLE_v10020687mg [Citrus clementina] ESR56973.1 hypothetical protein CICLE_v10020687mg [Citrus clementina] ESR56974.1 hypothetical protein CICLE_v10020687mg [Citrus clementina] Length = 370 Score = 89.7 bits (221), Expect = 8e-19 Identities = 45/59 (76%), Positives = 48/59 (81%), Gaps = 8/59 (13%) Frame = +2 Query: 200 MLLRSSSTPILGSLLS-------NNHETN-TFKHHLPPPSPATTIHHSHNYNKHSCVAF 352 MLLRSSSTP+LGSLLS +NHETN TFKHHLPPPSP TTIHHSH+YNK SC AF Sbjct: 1 MLLRSSSTPVLGSLLSPIQEGPSSNHETNATFKHHLPPPSPTTTIHHSHSYNKLSCAAF 59