BLASTX nr result
ID: Perilla23_contig00030684
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00030684 (383 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012853570.1| PREDICTED: pentatricopeptide repeat-containi... 85 2e-14 gb|EYU46193.1| hypothetical protein MIMGU_mgv1a026384mg [Erythra... 85 2e-14 ref|XP_011080412.1| PREDICTED: pentatricopeptide repeat-containi... 79 2e-12 ref|XP_006346263.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-08 ref|XP_004244115.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-08 ref|XP_009630034.1| PREDICTED: pentatricopeptide repeat-containi... 63 7e-08 ref|XP_009796972.1| PREDICTED: pentatricopeptide repeat-containi... 62 2e-07 ref|XP_009773519.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 ref|XP_009379032.1| PREDICTED: pentatricopeptide repeat-containi... 58 3e-06 ref|XP_007226735.1| hypothetical protein PRUPE_ppa019161mg [Prun... 58 3e-06 ref|XP_008378727.1| PREDICTED: pentatricopeptide repeat-containi... 57 4e-06 ref|XP_008219082.1| PREDICTED: pentatricopeptide repeat-containi... 57 4e-06 gb|KDO54786.1| hypothetical protein CISIN_1g004976mg [Citrus sin... 57 4e-06 ref|XP_006470533.1| PREDICTED: pentatricopeptide repeat-containi... 57 4e-06 ref|XP_006446305.1| hypothetical protein CICLE_v100144561mg, par... 57 5e-06 ref|XP_004301453.2| PREDICTED: pentatricopeptide repeat-containi... 56 9e-06 >ref|XP_012853570.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Erythranthe guttatus] gi|848848706|ref|XP_012853630.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Erythranthe guttatus] gi|848848710|ref|XP_012853693.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Erythranthe guttatus] gi|848848713|ref|XP_012853760.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Erythranthe guttatus] gi|848848716|ref|XP_012853815.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Erythranthe guttatus] gi|848848720|ref|XP_012853859.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Erythranthe guttatus] gi|848848724|ref|XP_012853912.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Erythranthe guttatus] Length = 745 Score = 84.7 bits (208), Expect = 2e-14 Identities = 39/57 (68%), Positives = 49/57 (85%) Frame = -2 Query: 382 LTSTILTCVCDLPEGHDIAELLPSFTQEKESGSSIPCDELLRRLQNIIPALQTCTPQ 212 +TSTILTC+CD+ EG D+ +L+P FTQEK GSSIPCDELLRRL+NI+P L+T +PQ Sbjct: 686 ITSTILTCLCDVSEGCDVVKLIPKFTQEKLEGSSIPCDELLRRLENIVPTLRT-SPQ 741 >gb|EYU46193.1| hypothetical protein MIMGU_mgv1a026384mg [Erythranthe guttata] Length = 641 Score = 84.7 bits (208), Expect = 2e-14 Identities = 39/57 (68%), Positives = 49/57 (85%) Frame = -2 Query: 382 LTSTILTCVCDLPEGHDIAELLPSFTQEKESGSSIPCDELLRRLQNIIPALQTCTPQ 212 +TSTILTC+CD+ EG D+ +L+P FTQEK GSSIPCDELLRRL+NI+P L+T +PQ Sbjct: 582 ITSTILTCLCDVSEGCDVVKLIPKFTQEKLEGSSIPCDELLRRLENIVPTLRT-SPQ 637 >ref|XP_011080412.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Sesamum indicum] gi|747067389|ref|XP_011080414.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Sesamum indicum] gi|747067391|ref|XP_011080415.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Sesamum indicum] Length = 742 Score = 78.6 bits (192), Expect = 2e-12 Identities = 35/53 (66%), Positives = 44/53 (83%) Frame = -2 Query: 382 LTSTILTCVCDLPEGHDIAELLPSFTQEKESGSSIPCDELLRRLQNIIPALQT 224 LTSTILTC+CD+ +GHD+ LPSFTQEK GSSI CD+LL +LQ+I+P LQ+ Sbjct: 682 LTSTILTCLCDISDGHDVLMHLPSFTQEKSKGSSIRCDDLLTKLQDIVPMLQS 734 >ref|XP_006346263.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like [Solanum tuberosum] Length = 737 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/52 (55%), Positives = 39/52 (75%) Frame = -2 Query: 382 LTSTILTCVCDLPEGHDIAELLPSFTQEKESGSSIPCDELLRRLQNIIPALQ 227 LTSTIL C+C++ E ++ ELLP+F+Q+K G SIPC ELL +LQ +P LQ Sbjct: 681 LTSTILQCLCNISEDLNVEELLPNFSQKKSEGFSIPCSELLMKLQKSLPKLQ 732 >ref|XP_004244115.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Solanum lycopersicum] gi|723718312|ref|XP_010324314.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Solanum lycopersicum] gi|723718315|ref|XP_010324315.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Solanum lycopersicum] Length = 737 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/52 (55%), Positives = 39/52 (75%) Frame = -2 Query: 382 LTSTILTCVCDLPEGHDIAELLPSFTQEKESGSSIPCDELLRRLQNIIPALQ 227 LTSTIL C+C++ E ++ ELLP+F+Q+K G SIPC ELL +LQ +P LQ Sbjct: 681 LTSTILECLCNISEDLNVEELLPNFSQKKSEGFSIPCSELLMKLQKSLPELQ 732 >ref|XP_009630034.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like [Nicotiana tomentosiformis] gi|697151620|ref|XP_009630035.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like [Nicotiana tomentosiformis] gi|697151622|ref|XP_009630036.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like [Nicotiana tomentosiformis] gi|697151624|ref|XP_009630037.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like [Nicotiana tomentosiformis] gi|697151626|ref|XP_009630038.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like [Nicotiana tomentosiformis] gi|697151628|ref|XP_009630039.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like [Nicotiana tomentosiformis] gi|697151630|ref|XP_009630040.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like [Nicotiana tomentosiformis] gi|697151632|ref|XP_009630042.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like [Nicotiana tomentosiformis] Length = 841 Score = 63.2 bits (152), Expect = 7e-08 Identities = 30/57 (52%), Positives = 41/57 (71%) Frame = -2 Query: 382 LTSTILTCVCDLPEGHDIAELLPSFTQEKESGSSIPCDELLRRLQNIIPALQTCTPQ 212 LTSTILTC+C++ E ++AELLP+F++EK SIPC ELL +L N + LQ + Q Sbjct: 782 LTSTILTCLCNISEDVNVAELLPNFSREKSEVFSIPCSELLNKLHNSLSKLQLDSAQ 838 >ref|XP_009796972.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like [Nicotiana sylvestris] Length = 841 Score = 62.0 bits (149), Expect = 2e-07 Identities = 30/57 (52%), Positives = 40/57 (70%) Frame = -2 Query: 382 LTSTILTCVCDLPEGHDIAELLPSFTQEKESGSSIPCDELLRRLQNIIPALQTCTPQ 212 LTSTILTC+C++ E ++AELLP+F+ EK SIPC ELL +L N + LQ + Q Sbjct: 782 LTSTILTCLCNISEDVNVAELLPNFSGEKSEVFSIPCSELLNKLHNSLSKLQLDSAQ 838 >ref|XP_009773519.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010 [Nicotiana sylvestris] Length = 733 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/57 (49%), Positives = 37/57 (64%) Frame = -2 Query: 382 LTSTILTCVCDLPEGHDIAELLPSFTQEKESGSSIPCDELLRRLQNIIPALQTCTPQ 212 +TSTIL C+C+ E ++ ELLP F+Q+ G SIPC ELL +L IP LQ + Q Sbjct: 677 ITSTILECLCNFSEDINVEELLPKFSQKTSEGFSIPCSELLMKLHKSIPKLQLDSAQ 733 >ref|XP_009379032.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like [Pyrus x bretschneideri] gi|694316198|ref|XP_009379037.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like [Pyrus x bretschneideri] Length = 733 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/58 (43%), Positives = 40/58 (68%) Frame = -2 Query: 382 LTSTILTCVCDLPEGHDIAELLPSFTQEKESGSSIPCDELLRRLQNIIPALQTCTPQP 209 +TSTIL C+C++ + D+ ++LP+F+QE G+SI C+ELL +L N P L+ +P Sbjct: 672 ITSTILECLCEISDDVDVMKILPTFSQETSKGASITCNELLVKLSNSHPELKLSQERP 729 >ref|XP_007226735.1| hypothetical protein PRUPE_ppa019161mg [Prunus persica] gi|462423671|gb|EMJ27934.1| hypothetical protein PRUPE_ppa019161mg [Prunus persica] Length = 626 Score = 57.8 bits (138), Expect = 3e-06 Identities = 23/52 (44%), Positives = 38/52 (73%) Frame = -2 Query: 382 LTSTILTCVCDLPEGHDIAELLPSFTQEKESGSSIPCDELLRRLQNIIPALQ 227 +TSTIL+C+C + + +D+ ++LP+F+QE G+SI C+ELL +L P L+ Sbjct: 574 ITSTILSCLCQISDDYDVMKILPTFSQETSKGASISCNELLMKLNKCYPELK 625 >ref|XP_008378727.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like [Malus domestica] gi|657973828|ref|XP_008378728.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like [Malus domestica] gi|657973830|ref|XP_008378729.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like [Malus domestica] Length = 733 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/58 (43%), Positives = 40/58 (68%) Frame = -2 Query: 382 LTSTILTCVCDLPEGHDIAELLPSFTQEKESGSSIPCDELLRRLQNIIPALQTCTPQP 209 +TSTIL C+C++ + D+ ++LP+F+QE G+SI C+ELL +L N P L+ +P Sbjct: 672 ITSTILECLCEISDDVDVMKILPTFSQETSKGASITCNELLVKLSNSHPELKLSHERP 729 >ref|XP_008219082.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like [Prunus mume] gi|645224385|ref|XP_008219083.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like [Prunus mume] Length = 626 Score = 57.4 bits (137), Expect = 4e-06 Identities = 23/52 (44%), Positives = 38/52 (73%) Frame = -2 Query: 382 LTSTILTCVCDLPEGHDIAELLPSFTQEKESGSSIPCDELLRRLQNIIPALQ 227 +TSTIL+C+C + + +D+ ++LP+F+QE G+SI C+ELL +L P L+ Sbjct: 574 ITSTILSCLCQISDDYDVMKILPTFSQETSKGASISCNELLMKLNKSYPELK 625 >gb|KDO54786.1| hypothetical protein CISIN_1g004976mg [Citrus sinensis] Length = 721 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/52 (50%), Positives = 36/52 (69%) Frame = -2 Query: 382 LTSTILTCVCDLPEGHDIAELLPSFTQEKESGSSIPCDELLRRLQNIIPALQ 227 LTSTIL C+C++ E D+A+L P+F+QE G SI C +LL +LQ P L+ Sbjct: 666 LTSTILVCLCNISEDLDVAKLFPTFSQETSKGKSISCKDLLLKLQEYHPELR 717 >ref|XP_006470533.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like isoform X1 [Citrus sinensis] gi|568832635|ref|XP_006470534.1| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like isoform X2 [Citrus sinensis] Length = 721 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/52 (50%), Positives = 36/52 (69%) Frame = -2 Query: 382 LTSTILTCVCDLPEGHDIAELLPSFTQEKESGSSIPCDELLRRLQNIIPALQ 227 LTSTIL C+C++ E D+A+L P+F+QE G SI C +LL +LQ P L+ Sbjct: 666 LTSTILVCLCNISEDLDVAKLFPTFSQETSKGKSISCKDLLLKLQEYRPELR 717 >ref|XP_006446305.1| hypothetical protein CICLE_v100144561mg, partial [Citrus clementina] gi|557548916|gb|ESR59545.1| hypothetical protein CICLE_v100144561mg, partial [Citrus clementina] Length = 162 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/52 (50%), Positives = 36/52 (69%) Frame = -2 Query: 382 LTSTILTCVCDLPEGHDIAELLPSFTQEKESGSSIPCDELLRRLQNIIPALQ 227 LTSTIL C+C++ E D+A+L P+F+QE G SI C +LL +LQ P L+ Sbjct: 107 LTSTILICLCNISEDLDVAKLFPTFSQETSKGKSISCKDLLLKLQECHPELR 158 >ref|XP_004301453.2| PREDICTED: pentatricopeptide repeat-containing protein At4g28010-like [Fragaria vesca subsp. vesca] Length = 191 Score = 56.2 bits (134), Expect = 9e-06 Identities = 23/54 (42%), Positives = 37/54 (68%) Frame = -2 Query: 382 LTSTILTCVCDLPEGHDIAELLPSFTQEKESGSSIPCDELLRRLQNIIPALQTC 221 +TSTIL C+C + + D+ E+LP+F++E +G SI C+ELL ++ P L+ C Sbjct: 136 ITSTILVCLCQISDNVDVMEVLPNFSRETSNGISITCNELLMKVNKSYPELKLC 189