BLASTX nr result
ID: Perilla23_contig00028815
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00028815 (579 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012849833.1| PREDICTED: UDP-galactose/UDP-glucose transpo... 66 1e-08 gb|EYU36250.1| hypothetical protein MIMGU_mgv1a010235mg [Erythra... 66 1e-08 gb|EYU26985.1| hypothetical protein MIMGU_mgv1a023524mg, partial... 66 1e-08 ref|XP_011089835.1| PREDICTED: UDP-galactose/UDP-glucose transpo... 65 3e-08 >ref|XP_012849833.1| PREDICTED: UDP-galactose/UDP-glucose transporter 5B-like, partial [Erythranthe guttatus] Length = 325 Score = 66.2 bits (160), Expect = 1e-08 Identities = 33/43 (76%), Positives = 36/43 (83%) Frame = -1 Query: 579 LSAEQLIGAVIVFGSIYSNSYFRSKPKPLPSEQTENRAVSPPR 451 LS+EQLIGAVIVFGSIYS + FRSKPKP EQTEN + SPPR Sbjct: 279 LSSEQLIGAVIVFGSIYSKNIFRSKPKPTLPEQTENGSSSPPR 321 >gb|EYU36250.1| hypothetical protein MIMGU_mgv1a010235mg [Erythranthe guttata] Length = 318 Score = 66.2 bits (160), Expect = 1e-08 Identities = 33/43 (76%), Positives = 36/43 (83%) Frame = -1 Query: 579 LSAEQLIGAVIVFGSIYSNSYFRSKPKPLPSEQTENRAVSPPR 451 LS+EQLIGAVIVFGSIYS + FRSKPKP EQTEN + SPPR Sbjct: 272 LSSEQLIGAVIVFGSIYSKNIFRSKPKPTLPEQTENGSSSPPR 314 >gb|EYU26985.1| hypothetical protein MIMGU_mgv1a023524mg, partial [Erythranthe guttata] Length = 308 Score = 66.2 bits (160), Expect = 1e-08 Identities = 33/43 (76%), Positives = 36/43 (83%) Frame = -1 Query: 579 LSAEQLIGAVIVFGSIYSNSYFRSKPKPLPSEQTENRAVSPPR 451 LS+EQLIGAVIVFGSIYS + FRSKPKP EQTEN + SPPR Sbjct: 262 LSSEQLIGAVIVFGSIYSKNIFRSKPKPTLPEQTENGSSSPPR 304 >ref|XP_011089835.1| PREDICTED: UDP-galactose/UDP-glucose transporter 5B-like [Sesamum indicum] gi|747084823|ref|XP_011089836.1| PREDICTED: UDP-galactose/UDP-glucose transporter 5B-like [Sesamum indicum] Length = 345 Score = 64.7 bits (156), Expect = 3e-08 Identities = 31/46 (67%), Positives = 37/46 (80%) Frame = -1 Query: 579 LSAEQLIGAVIVFGSIYSNSYFRSKPKPLPSEQTENRAVSPPRTRS 442 LSAEQLIGAVIVFG++YS S+ +SKP PL SEQTEN A +P R + Sbjct: 300 LSAEQLIGAVIVFGTLYSKSFLKSKPVPLSSEQTENEASAPARANT 345