BLASTX nr result
ID: Perilla23_contig00028679
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00028679 (332 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36513.1| hypothetical protein MIMGU_mgv11b018711mg [Erythr... 73 1e-10 ref|XP_012838238.1| PREDICTED: uncharacterized protein LOC105958... 72 1e-10 ref|XP_011074172.1| PREDICTED: uncharacterized protein LOC105158... 71 4e-10 ref|XP_012853605.1| PREDICTED: uncharacterized protein LOC105973... 70 6e-10 gb|EYU23811.1| hypothetical protein MIMGU_mgv1a013682mg [Erythra... 70 6e-10 ref|XP_012838239.1| PREDICTED: uncharacterized protein LOC105958... 70 8e-10 ref|XP_011098590.1| PREDICTED: uncharacterized protein LOC105177... 69 2e-09 gb|EYU23210.1| hypothetical protein MIMGU_mgv1a018702mg, partial... 69 2e-09 ref|XP_012853606.1| PREDICTED: uncharacterized protein LOC105973... 68 2e-09 gb|EYU36514.1| hypothetical protein MIMGU_mgv11b017281mg [Erythr... 68 2e-09 ref|XP_012853604.1| PREDICTED: uncharacterized protein LOC105973... 67 5e-09 gb|EYU23813.1| hypothetical protein MIMGU_mgv11b0151381mg, parti... 67 5e-09 ref|XP_012854402.1| PREDICTED: uncharacterized protein LOC105973... 67 7e-09 ref|XP_011074163.1| PREDICTED: uncharacterized protein LOC105158... 66 9e-09 ref|XP_012838240.1| PREDICTED: uncharacterized protein LOC105958... 65 2e-08 ref|XP_011098064.1| PREDICTED: uncharacterized protein LOC105176... 62 2e-07 ref|XP_012829880.1| PREDICTED: uncharacterized protein LOC105951... 61 3e-07 ref|XP_011098077.1| PREDICTED: uncharacterized protein LOC105176... 61 3e-07 ref|XP_012854435.1| PREDICTED: uncharacterized protein LOC105973... 58 2e-06 gb|EYU23213.1| hypothetical protein MIMGU_mgv1a010061mg [Erythra... 58 2e-06 >gb|EYU36513.1| hypothetical protein MIMGU_mgv11b018711mg [Erythranthe guttata] Length = 283 Score = 72.8 bits (177), Expect = 1e-10 Identities = 32/62 (51%), Positives = 45/62 (72%) Frame = -2 Query: 331 YKPRIEVLEVLESRHLIETWPLLSSLCRMPDHTFYKKYVNPHLKEVGEIYQAHRARSKKR 152 YKPR++VL VLESR+LI WP S+L +MPD +F KKYV P+L EVG++++ + K Sbjct: 222 YKPRLQVLGVLESRNLINNWPSFSALYKMPDESFVKKYVGPYLSEVGDLHKVESSFCAKN 281 Query: 151 GV 146 G+ Sbjct: 282 GL 283 >ref|XP_012838238.1| PREDICTED: uncharacterized protein LOC105958780 [Erythranthe guttatus] Length = 592 Score = 72.4 bits (176), Expect = 1e-10 Identities = 32/61 (52%), Positives = 44/61 (72%) Frame = -2 Query: 331 YKPRIEVLEVLESRHLIETWPLLSSLCRMPDHTFYKKYVNPHLKEVGEIYQAHRARSKKR 152 YKPR++VL VLESR+LI WP S+L +MPD +F KKYV P+L EVG++++ + K Sbjct: 138 YKPRLQVLGVLESRNLINNWPSFSALYKMPDESFVKKYVGPYLSEVGDLHKVESSFCAKN 197 Query: 151 G 149 G Sbjct: 198 G 198 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/52 (55%), Positives = 37/52 (71%) Frame = -2 Query: 331 YKPRIEVLEVLESRHLIETWPLLSSLCRMPDHTFYKKYVNPHLKEVGEIYQA 176 Y PR +VLE+LES LIE WP L+ LCRM FY+K+V P+L VG++Y A Sbjct: 525 YMPRFKVLEILESEGLIEKWPCLAVLCRMSGKKFYEKFVGPYLDRVGDVYVA 576 >ref|XP_011074172.1| PREDICTED: uncharacterized protein LOC105158947 [Sesamum indicum] Length = 407 Score = 70.9 bits (172), Expect = 4e-10 Identities = 33/64 (51%), Positives = 43/64 (67%) Frame = -2 Query: 331 YKPRIEVLEVLESRHLIETWPLLSSLCRMPDHTFYKKYVNPHLKEVGEIYQAHRARSKKR 152 YKPR+++L +LESR+LIE WP +L +M D F+KKYV P+L EVG + RA KR Sbjct: 326 YKPRLQMLGILESRNLIEDWPNFPALYKMSDEAFFKKYVGPYLNEVGHLSMVKRAFRVKR 385 Query: 151 GVEL 140 EL Sbjct: 386 DAEL 389 >ref|XP_012853605.1| PREDICTED: uncharacterized protein LOC105973131 [Erythranthe guttatus] Length = 388 Score = 70.1 bits (170), Expect = 6e-10 Identities = 31/62 (50%), Positives = 45/62 (72%) Frame = -2 Query: 331 YKPRIEVLEVLESRHLIETWPLLSSLCRMPDHTFYKKYVNPHLKEVGEIYQAHRARSKKR 152 YKPR++VL VLESR+LI+ WP L +MPD +F KKYV P+L+EVG++++ + K Sbjct: 327 YKPRLQVLGVLESRNLIKEWPSFPGLYKMPDESFVKKYVRPYLREVGDLHKVGSSFCGKN 386 Query: 151 GV 146 G+ Sbjct: 387 GL 388 >gb|EYU23811.1| hypothetical protein MIMGU_mgv1a013682mg [Erythranthe guttata] Length = 213 Score = 70.1 bits (170), Expect = 6e-10 Identities = 31/62 (50%), Positives = 45/62 (72%) Frame = -2 Query: 331 YKPRIEVLEVLESRHLIETWPLLSSLCRMPDHTFYKKYVNPHLKEVGEIYQAHRARSKKR 152 YKPR++VL VLESR+LI+ WP L +MPD +F KKYV P+L+EVG++++ + K Sbjct: 152 YKPRLQVLGVLESRNLIKEWPSFPGLYKMPDESFVKKYVRPYLREVGDLHKVGSSFCGKN 211 Query: 151 GV 146 G+ Sbjct: 212 GL 213 >ref|XP_012838239.1| PREDICTED: uncharacterized protein LOC105958781 [Erythranthe guttatus] Length = 374 Score = 69.7 bits (169), Expect = 8e-10 Identities = 30/63 (47%), Positives = 44/63 (69%) Frame = -2 Query: 331 YKPRIEVLEVLESRHLIETWPLLSSLCRMPDHTFYKKYVNPHLKEVGEIYQAHRARSKKR 152 YKPRI VLE+LESR++I WP LS LCR+ + F++K+V P+L VG++Y A + + Sbjct: 310 YKPRIRVLEILESRNVIVRWPCLSVLCRVSEKDFFEKFVGPYLDHVGDVYVASARKGDAK 369 Query: 151 GVE 143 +E Sbjct: 370 QIE 372 >ref|XP_011098590.1| PREDICTED: uncharacterized protein LOC105177221 [Sesamum indicum] Length = 390 Score = 68.6 bits (166), Expect = 2e-09 Identities = 30/55 (54%), Positives = 39/55 (70%) Frame = -2 Query: 331 YKPRIEVLEVLESRHLIETWPLLSSLCRMPDHTFYKKYVNPHLKEVGEIYQAHRA 167 YKPR EVL +LESRHLI+ WP L ++ RMPD F++ +V P+L EVG Y +A Sbjct: 326 YKPRFEVLGILESRHLIDKWPRLGAIYRMPDDKFFEVFVGPYLNEVGGAYLGQKA 380 >gb|EYU23210.1| hypothetical protein MIMGU_mgv1a018702mg, partial [Erythranthe guttata] Length = 361 Score = 68.6 bits (166), Expect = 2e-09 Identities = 28/55 (50%), Positives = 43/55 (78%), Gaps = 1/55 (1%) Frame = -2 Query: 331 YKPRIEVLEVLESRHLIETWPLLSSLCRMPDHTFYKKYVNPHLKEV-GEIYQAHR 170 YKPR ++L +LESR+LI WP LS++C++PD F+ +Y+ PHL E+ G++Y A+R Sbjct: 265 YKPRFQILGILESRNLINYWPGLSTICKLPDDKFFGRYIGPHLSELGGQVYVANR 319 >ref|XP_012853606.1| PREDICTED: uncharacterized protein LOC105973132 [Erythranthe guttatus] Length = 386 Score = 68.2 bits (165), Expect = 2e-09 Identities = 29/52 (55%), Positives = 38/52 (73%) Frame = -2 Query: 331 YKPRIEVLEVLESRHLIETWPLLSSLCRMPDHTFYKKYVNPHLKEVGEIYQA 176 YKPR +VLE+LE LIE WP L+ LCRM FY+K+V P+L +VG++Y A Sbjct: 319 YKPRFKVLEILEGEGLIEKWPCLAVLCRMSGKKFYEKFVGPYLDQVGDVYMA 370 >gb|EYU36514.1| hypothetical protein MIMGU_mgv11b017281mg [Erythranthe guttata] Length = 453 Score = 68.2 bits (165), Expect = 2e-09 Identities = 30/58 (51%), Positives = 39/58 (67%) Frame = -2 Query: 331 YKPRIEVLEVLESRHLIETWPLLSSLCRMPDHTFYKKYVNPHLKEVGEIYQAHRARSK 158 Y PR +VLE+LES LIE WP L+ LCRM FY+K+V P+L VG++Y A R + Sbjct: 319 YMPRFKVLEILESEGLIEKWPCLAVLCRMSGKKFYEKFVGPYLDRVGDVYVAKECRKR 376 >ref|XP_012853604.1| PREDICTED: uncharacterized protein LOC105973130 [Erythranthe guttatus] Length = 258 Score = 67.0 bits (162), Expect = 5e-09 Identities = 28/63 (44%), Positives = 44/63 (69%) Frame = -2 Query: 331 YKPRIEVLEVLESRHLIETWPLLSSLCRMPDHTFYKKYVNPHLKEVGEIYQAHRARSKKR 152 Y+PR +VLE+LE ++LI+ WP S+L +M D+ F++K+V PH EVGE Y ++K+ Sbjct: 190 YEPRFQVLEILERKNLIKNWPSFSALYKMTDNKFFEKFVGPHYNEVGEAYMKKCVLARKK 249 Query: 151 GVE 143 V+ Sbjct: 250 EVD 252 >gb|EYU23813.1| hypothetical protein MIMGU_mgv11b0151381mg, partial [Erythranthe guttata] Length = 272 Score = 67.0 bits (162), Expect = 5e-09 Identities = 28/63 (44%), Positives = 44/63 (69%) Frame = -2 Query: 331 YKPRIEVLEVLESRHLIETWPLLSSLCRMPDHTFYKKYVNPHLKEVGEIYQAHRARSKKR 152 Y+PR +VLE+LE ++LI+ WP S+L +M D+ F++K+V PH EVGE Y ++K+ Sbjct: 204 YEPRFQVLEILERKNLIKNWPSFSALYKMTDNKFFEKFVGPHYNEVGEAYMKKCVLARKK 263 Query: 151 GVE 143 V+ Sbjct: 264 EVD 266 >ref|XP_012854402.1| PREDICTED: uncharacterized protein LOC105973907 [Erythranthe guttatus] Length = 380 Score = 66.6 bits (161), Expect = 7e-09 Identities = 27/54 (50%), Positives = 42/54 (77%), Gaps = 1/54 (1%) Frame = -2 Query: 331 YKPRIEVLEVLESRHLIETWPLLSSLCRMPDHTFYKKYVNPHLKEV-GEIYQAH 173 YKPR ++L +LESR+LI WP LS++C++PD F+ +Y+ PHL E+ G++Y A+ Sbjct: 317 YKPRFQILGILESRNLINYWPGLSTICKLPDDKFFGRYIGPHLSELGGQVYVAN 370 >ref|XP_011074163.1| PREDICTED: uncharacterized protein LOC105158945 isoform X1 [Sesamum indicum] gi|747055834|ref|XP_011074164.1| PREDICTED: uncharacterized protein LOC105158945 isoform X1 [Sesamum indicum] gi|747055836|ref|XP_011074165.1| PREDICTED: uncharacterized protein LOC105158945 isoform X1 [Sesamum indicum] Length = 359 Score = 66.2 bits (160), Expect = 9e-09 Identities = 30/62 (48%), Positives = 42/62 (67%) Frame = -2 Query: 331 YKPRIEVLEVLESRHLIETWPLLSSLCRMPDHTFYKKYVNPHLKEVGEIYQAHRARSKKR 152 YKPR +VLE+LE ++LI WP +L +M D F++K+V+P+ EVGE+Y A S KR Sbjct: 298 YKPRFQVLEILEGKNLITNWPGFPTLFKMTDKNFFEKFVHPYSDEVGEVYMAKGGLSGKR 357 Query: 151 GV 146 V Sbjct: 358 RV 359 >ref|XP_012838240.1| PREDICTED: uncharacterized protein LOC105958782 [Erythranthe guttatus] Length = 396 Score = 65.1 bits (157), Expect = 2e-08 Identities = 27/63 (42%), Positives = 45/63 (71%) Frame = -2 Query: 331 YKPRIEVLEVLESRHLIETWPLLSSLCRMPDHTFYKKYVNPHLKEVGEIYQAHRARSKKR 152 Y+PR +VLE+LE ++LI+ WP S+L +M D+ F++K+V+P+ EVGE Y ++K+ Sbjct: 322 YEPRFQVLEILERKNLIKNWPSFSALYKMTDNKFFEKFVSPYYNEVGEAYMKKCVLARKK 381 Query: 151 GVE 143 V+ Sbjct: 382 EVD 384 >ref|XP_011098064.1| PREDICTED: uncharacterized protein LOC105176833 [Sesamum indicum] Length = 380 Score = 62.0 bits (149), Expect = 2e-07 Identities = 27/50 (54%), Positives = 38/50 (76%) Frame = -2 Query: 331 YKPRIEVLEVLESRHLIETWPLLSSLCRMPDHTFYKKYVNPHLKEVGEIY 182 Y+PR++VLEVLE R+LI+ WP L ++ D F++K+V P+L EVGEIY Sbjct: 322 YRPRLQVLEVLEKRNLIKNWPALGTVNLTSDKKFFEKFVAPYLDEVGEIY 371 >ref|XP_012829880.1| PREDICTED: uncharacterized protein LOC105951033 [Erythranthe guttatus] Length = 371 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/50 (54%), Positives = 36/50 (72%) Frame = -2 Query: 331 YKPRIEVLEVLESRHLIETWPLLSSLCRMPDHTFYKKYVNPHLKEVGEIY 182 Y PR+ VLEVLE R+LI+ WP L + + D F+KK+V P+L EVGE+Y Sbjct: 319 YLPRLRVLEVLEKRNLIKKWPCLGTFHLLSDSKFFKKFVAPYLDEVGEVY 368 >ref|XP_011098077.1| PREDICTED: uncharacterized protein LOC105176842 [Sesamum indicum] Length = 380 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/59 (44%), Positives = 41/59 (69%) Frame = -2 Query: 331 YKPRIEVLEVLESRHLIETWPLLSSLCRMPDHTFYKKYVNPHLKEVGEIYQAHRARSKK 155 YKPR++VLE LE R+L++ WP ++ M D F++K+V P+L EVG+IY A + ++ Sbjct: 322 YKPRLQVLEALEKRNLLKNWPGFGTMHIMSDKKFFEKFVAPYLDEVGKIYTAKSVQKRR 380 >ref|XP_012854435.1| PREDICTED: uncharacterized protein LOC105973937 [Erythranthe guttatus] Length = 387 Score = 58.2 bits (139), Expect = 2e-06 Identities = 22/50 (44%), Positives = 38/50 (76%) Frame = -2 Query: 331 YKPRIEVLEVLESRHLIETWPLLSSLCRMPDHTFYKKYVNPHLKEVGEIY 182 +KPRI +LE+LESR+LI +WP L + + D F++K+++P++ EV ++Y Sbjct: 325 FKPRIRILEILESRNLITSWPGLGIVYTLTDEKFFQKFISPYMDEVSDVY 374 >gb|EYU23213.1| hypothetical protein MIMGU_mgv1a010061mg [Erythranthe guttata] Length = 323 Score = 58.2 bits (139), Expect = 2e-06 Identities = 22/50 (44%), Positives = 38/50 (76%) Frame = -2 Query: 331 YKPRIEVLEVLESRHLIETWPLLSSLCRMPDHTFYKKYVNPHLKEVGEIY 182 +KPRI +LE+LESR+LI +WP L + + D F++K+++P++ EV ++Y Sbjct: 261 FKPRIRILEILESRNLITSWPGLGIVYTLTDEKFFQKFISPYMDEVSDVY 310