BLASTX nr result
ID: Perilla23_contig00028621
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00028621 (428 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012855222.1| PREDICTED: uridine-cytidine kinase C [Erythr... 57 4e-06 >ref|XP_012855222.1| PREDICTED: uridine-cytidine kinase C [Erythranthe guttatus] gi|848914693|ref|XP_012855223.1| PREDICTED: uridine-cytidine kinase C [Erythranthe guttatus] gi|604303071|gb|EYU22596.1| hypothetical protein MIMGU_mgv1a002589mg [Erythranthe guttata] Length = 656 Score = 57.4 bits (137), Expect = 4e-06 Identities = 33/67 (49%), Positives = 43/67 (64%), Gaps = 1/67 (1%) Frame = -3 Query: 426 QRQVIIQXXXXXXXXXXXXXXRSINDRRRNRSQIAGNDSSR-VIMILASLAVGGMGICLF 250 QRQV+ Q +S+ DRR+ RS IA ND++R +++LASLAVGG+GI LF Sbjct: 590 QRQVMHQLDNLNNLLRENMGDKSVRDRRKKRSGIAENDTNRNAVILLASLAVGGLGIFLF 649 Query: 249 KGFSSRN 229 KG SRN Sbjct: 650 KGVLSRN 656