BLASTX nr result
ID: Perilla23_contig00028536
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00028536 (579 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011095703.1| PREDICTED: sperm-associated antigen 1-like [... 55 4e-11 ref|XP_011097633.1| PREDICTED: FK506-binding protein 59-like [Se... 42 7e-07 >ref|XP_011095703.1| PREDICTED: sperm-associated antigen 1-like [Sesamum indicum] Length = 264 Score = 55.5 bits (132), Expect(2) = 4e-11 Identities = 30/64 (46%), Positives = 39/64 (60%) Frame = -1 Query: 573 EPYEEVRDSEKVEDLGSSVNDVTCDAAEESNEKSNFEDVSLTDEIVPCQNKIRQLPSDQQ 394 E EE +DS++VED +D DAA N +S FE+V LT E + Q++ Q P DQQ Sbjct: 144 ENEEEEQDSKEVEDHHRREDDAIHDAAIADNNRSGFENVRLTTEPLTSQDQTTQRPPDQQ 203 Query: 393 SLGW 382 SLGW Sbjct: 204 SLGW 207 Score = 39.3 bits (90), Expect(2) = 4e-11 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -2 Query: 314 SQPQYRFRVKTVGVRAVK 261 SQPQYRFRVKTVGVRAVK Sbjct: 247 SQPQYRFRVKTVGVRAVK 264 >ref|XP_011097633.1| PREDICTED: FK506-binding protein 59-like [Sesamum indicum] Length = 268 Score = 42.0 bits (97), Expect(2) = 7e-07 Identities = 23/60 (38%), Positives = 34/60 (56%) Frame = -1 Query: 561 EVRDSEKVEDLGSSVNDVTCDAAEESNEKSNFEDVSLTDEIVPCQNKIRQLPSDQQSLGW 382 E +D ++VE+ G N V +AA N++S ++S EIV QN+ Q Q+SLGW Sbjct: 155 EKQDGKEVENFGGQENYVNDNAATAQNKESKSGNISSITEIVSSQNQSAQKTIVQKSLGW 214 Score = 38.1 bits (87), Expect(2) = 7e-07 Identities = 17/18 (94%), Positives = 18/18 (100%) Frame = -2 Query: 314 SQPQYRFRVKTVGVRAVK 261 S+PQYRFRVKTVGVRAVK Sbjct: 251 SEPQYRFRVKTVGVRAVK 268