BLASTX nr result
ID: Perilla23_contig00027777
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00027777 (380 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008238065.1| PREDICTED: uncharacterized protein LOC103336... 60 6e-07 ref|XP_008245511.1| PREDICTED: zinc finger MYM-type protein 1-li... 57 4e-06 >ref|XP_008238065.1| PREDICTED: uncharacterized protein LOC103336744 [Prunus mume] Length = 924 Score = 60.1 bits (144), Expect = 6e-07 Identities = 30/55 (54%), Positives = 36/55 (65%) Frame = -2 Query: 175 SSK*ENIQVDLENLPSDPEL*PNITSYPPDLIE*VRRAYLLKGPCQPCKHVFSQM 11 SSK +Q L NLP+DP L P + Y P++ E VRRAYL KGPCQP H F Q+ Sbjct: 561 SSKESKLQDVLANLPADPGLRPQMLDYDPNIREEVRRAYLQKGPCQPKDHTFPQI 615 >ref|XP_008245511.1| PREDICTED: zinc finger MYM-type protein 1-like [Prunus mume] Length = 788 Score = 57.4 bits (137), Expect = 4e-06 Identities = 30/53 (56%), Positives = 36/53 (67%) Frame = -2 Query: 178 ESSK*ENIQVDLENLPSDPEL*PNITSYPPDLIE*VRRAYLLKGPCQPCKHVF 20 ESS + +V+ ENLPSDP L I SY P++ + VRRAYL KGPCQP H F Sbjct: 26 ESSPNQTTEVNSENLPSDPGLRNQILSYHPNVQDQVRRAYLQKGPCQPRGHNF 78