BLASTX nr result
ID: Perilla23_contig00027680
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00027680 (481 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011073149.1| PREDICTED: extra-large guanine nucleotide-bi... 125 2e-26 ref|XP_012856185.1| PREDICTED: extra-large guanine nucleotide-bi... 107 4e-21 gb|EYU21864.1| hypothetical protein MIMGU_mgv1a026328mg [Erythra... 107 4e-21 ref|XP_011464474.1| PREDICTED: extra-large guanine nucleotide-bi... 71 3e-10 ref|XP_011464473.1| PREDICTED: extra-large guanine nucleotide-bi... 71 3e-10 ref|XP_009800322.1| PREDICTED: extra-large guanine nucleotide-bi... 71 3e-10 ref|XP_010318330.1| PREDICTED: extra-large guanine nucleotide-bi... 70 6e-10 ref|XP_009614689.1| PREDICTED: extra-large guanine nucleotide-bi... 70 8e-10 ref|XP_006363987.1| PREDICTED: extra-large guanine nucleotide-bi... 70 8e-10 ref|XP_008367614.1| PREDICTED: extra-large guanine nucleotide-bi... 69 2e-09 ref|XP_009360044.1| PREDICTED: extra-large guanine nucleotide-bi... 67 4e-09 ref|XP_009360043.1| PREDICTED: extra-large guanine nucleotide-bi... 67 4e-09 ref|XP_002318309.1| hypothetical protein POPTR_0012s03950g [Popu... 67 4e-09 ref|XP_012072921.1| PREDICTED: extra-large guanine nucleotide-bi... 67 5e-09 ref|XP_007036953.1| Extra-large GTP-binding protein 3 [Theobroma... 67 7e-09 ref|XP_010936874.1| PREDICTED: extra-large guanine nucleotide-bi... 66 9e-09 ref|XP_010936873.1| PREDICTED: extra-large guanine nucleotide-bi... 66 9e-09 ref|XP_009355999.1| PREDICTED: extra-large guanine nucleotide-bi... 66 9e-09 ref|XP_008776599.1| PREDICTED: extra-large guanine nucleotide-bi... 66 1e-08 ref|XP_006374248.1| hypothetical protein POPTR_0015s05370g [Popu... 66 1e-08 >ref|XP_011073149.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like [Sesamum indicum] Length = 821 Score = 125 bits (313), Expect = 2e-26 Identities = 55/69 (79%), Positives = 63/69 (91%) Frame = -1 Query: 397 WEDLLRKMLPEGAPLPDEDQLDYSISVDYVGPSPFFKPPNIDPMIPRSRFTTFPKRVPSL 218 W++LLRKMLPEGAPLPDEDQLDYSISVDY+GPSPFF PP ++P+IP+ RFTTFPK PSL Sbjct: 14 WDELLRKMLPEGAPLPDEDQLDYSISVDYIGPSPFFTPP-VNPVIPKERFTTFPKEAPSL 72 Query: 217 TPRNPAWMK 191 TPRN AW+K Sbjct: 73 TPRNTAWLK 81 >ref|XP_012856185.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like [Erythranthe guttatus] Length = 780 Score = 107 bits (266), Expect = 4e-21 Identities = 47/69 (68%), Positives = 56/69 (81%) Frame = -1 Query: 397 WEDLLRKMLPEGAPLPDEDQLDYSISVDYVGPSPFFKPPNIDPMIPRSRFTTFPKRVPSL 218 W +LLRKMLPEGAPLPD+DQLDYSISV+Y GP PF+ PP ++ P+ +FTTFPK PSL Sbjct: 17 WAELLRKMLPEGAPLPDDDQLDYSISVNYAGPPPFYNPPPLNSTFPKPKFTTFPKYPPSL 76 Query: 217 TPRNPAWMK 191 +PRNPA K Sbjct: 77 SPRNPASSK 85 >gb|EYU21864.1| hypothetical protein MIMGU_mgv1a026328mg [Erythranthe guttata] Length = 739 Score = 107 bits (266), Expect = 4e-21 Identities = 47/69 (68%), Positives = 56/69 (81%) Frame = -1 Query: 397 WEDLLRKMLPEGAPLPDEDQLDYSISVDYVGPSPFFKPPNIDPMIPRSRFTTFPKRVPSL 218 W +LLRKMLPEGAPLPD+DQLDYSISV+Y GP PF+ PP ++ P+ +FTTFPK PSL Sbjct: 17 WAELLRKMLPEGAPLPDDDQLDYSISVNYAGPPPFYNPPPLNSTFPKPKFTTFPKYPPSL 76 Query: 217 TPRNPAWMK 191 +PRNPA K Sbjct: 77 SPRNPASSK 85 >ref|XP_011464474.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like isoform X2 [Fragaria vesca subsp. vesca] Length = 843 Score = 71.2 bits (173), Expect = 3e-10 Identities = 30/44 (68%), Positives = 37/44 (84%) Frame = -1 Query: 397 WEDLLRKMLPEGAPLPDEDQLDYSISVDYVGPSPFFKPPNIDPM 266 WE+LLRKMLP GAPLPDED LDYSI+V+YVGP ++ P +DP+ Sbjct: 12 WEELLRKMLPSGAPLPDEDHLDYSIAVEYVGPPLSYEVPKVDPV 55 >ref|XP_011464473.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like isoform X1 [Fragaria vesca subsp. vesca] Length = 844 Score = 71.2 bits (173), Expect = 3e-10 Identities = 30/44 (68%), Positives = 37/44 (84%) Frame = -1 Query: 397 WEDLLRKMLPEGAPLPDEDQLDYSISVDYVGPSPFFKPPNIDPM 266 WE+LLRKMLP GAPLPDED LDYSI+V+YVGP ++ P +DP+ Sbjct: 12 WEELLRKMLPSGAPLPDEDHLDYSIAVEYVGPPLSYEVPKVDPV 55 >ref|XP_009800322.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like [Nicotiana sylvestris] Length = 614 Score = 71.2 bits (173), Expect = 3e-10 Identities = 35/63 (55%), Positives = 46/63 (73%), Gaps = 3/63 (4%) Frame = -1 Query: 397 WEDLLRKMLPEGAPLPDEDQLDYSISVDYVGPSPFFKPPNIDPMI-PRSRFTTFPK--RV 227 W+DLLR+MLP GAPLPDE+QLDYSI+++Y GP F P +DP+ +S T PK +V Sbjct: 13 WQDLLRRMLPAGAPLPDEEQLDYSIAIEYKGPPLDFPVPVVDPLASSQSTLTKLPKFRKV 72 Query: 226 PSL 218 PS+ Sbjct: 73 PSV 75 >ref|XP_010318330.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like [Solanum lycopersicum] Length = 847 Score = 70.1 bits (170), Expect = 6e-10 Identities = 36/65 (55%), Positives = 46/65 (70%), Gaps = 5/65 (7%) Frame = -1 Query: 397 WEDLLRKMLPEGAPLPDEDQLDYSISVDYVGPSPFFKPPNIDPMIPRSRFTTFPK----- 233 W+DLLR+MLP GAPLPD++QLDYSI+V+Y GP F P +DP+ S TT PK Sbjct: 13 WQDLLRRMLPAGAPLPDDEQLDYSIAVEYKGPPLDFPVPVVDPL---SSKTTLPKPPKYR 69 Query: 232 RVPSL 218 +VPS+ Sbjct: 70 KVPSV 74 >ref|XP_009614689.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like [Nicotiana tomentosiformis] Length = 852 Score = 69.7 bits (169), Expect = 8e-10 Identities = 36/63 (57%), Positives = 45/63 (71%), Gaps = 3/63 (4%) Frame = -1 Query: 397 WEDLLRKMLPEGAPLPDEDQLDYSISVDYVGPSPFFKPPNIDPMI-PRSRFTTFPK--RV 227 W DLLR+MLP GAPLPDE+QLDYSI+V+Y GP F P +DP+ +S T PK +V Sbjct: 13 WLDLLRRMLPAGAPLPDEEQLDYSIAVEYKGPPLDFPVPVVDPLASSQSTLTKLPKFRKV 72 Query: 226 PSL 218 PS+ Sbjct: 73 PSV 75 >ref|XP_006363987.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like [Solanum tuberosum] Length = 844 Score = 69.7 bits (169), Expect = 8e-10 Identities = 33/62 (53%), Positives = 45/62 (72%), Gaps = 2/62 (3%) Frame = -1 Query: 397 WEDLLRKMLPEGAPLPDEDQLDYSISVDYVGPSPFFKPPNIDPMIPRSRFTTFPK--RVP 224 W+DLLR+MLP GAPLPD++QLDYSI+V+Y GP F P +DP+ ++ PK +VP Sbjct: 13 WQDLLRRMLPAGAPLPDDEQLDYSIAVEYKGPPLDFPVPVVDPLSSQTTLQKPPKYRKVP 72 Query: 223 SL 218 S+ Sbjct: 73 SV 74 >ref|XP_008367614.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like [Malus domestica] Length = 875 Score = 68.6 bits (166), Expect = 2e-09 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = -1 Query: 397 WEDLLRKMLPEGAPLPDEDQLDYSISVDYVGPSPFFKPPNIDPM 266 WEDLLRKMLP GAPLPDE+ LDYSI+V+Y G + PP +DP+ Sbjct: 11 WEDLLRKMLPAGAPLPDEEHLDYSIAVEYEGSPLHYDPPKVDPV 54 >ref|XP_009360044.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like isoform X2 [Pyrus x bretschneideri] Length = 874 Score = 67.4 bits (163), Expect = 4e-09 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = -1 Query: 397 WEDLLRKMLPEGAPLPDEDQLDYSISVDYVGPSPFFKPPNIDPM 266 WEDLLRKMLP GAPLPDE+ LDYSI+V+Y G + PP +DP+ Sbjct: 11 WEDLLRKMLPAGAPLPDEEHLDYSIAVEYEGSPLPYDPPKVDPV 54 >ref|XP_009360043.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like isoform X1 [Pyrus x bretschneideri] Length = 875 Score = 67.4 bits (163), Expect = 4e-09 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = -1 Query: 397 WEDLLRKMLPEGAPLPDEDQLDYSISVDYVGPSPFFKPPNIDPM 266 WEDLLRKMLP GAPLPDE+ LDYSI+V+Y G + PP +DP+ Sbjct: 11 WEDLLRKMLPAGAPLPDEEHLDYSIAVEYEGSPLPYDPPKVDPV 54 >ref|XP_002318309.1| hypothetical protein POPTR_0012s03950g [Populus trichocarpa] gi|222858982|gb|EEE96529.1| hypothetical protein POPTR_0012s03950g [Populus trichocarpa] Length = 803 Score = 67.4 bits (163), Expect = 4e-09 Identities = 32/60 (53%), Positives = 40/60 (66%) Frame = -1 Query: 397 WEDLLRKMLPEGAPLPDEDQLDYSISVDYVGPSPFFKPPNIDPMIPRSRFTTFPKRVPSL 218 WE+++RKMLP GAPLPDED LDYSI+V+Y GP ++ P IDP+ P R SL Sbjct: 11 WEEVIRKMLPAGAPLPDEDHLDYSIAVEYEGPPIPYEVPRIDPL----NLNLLPTRASSL 66 >ref|XP_012072921.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like [Jatropha curcas] gi|643729639|gb|KDP37427.1| hypothetical protein JCGZ_07954 [Jatropha curcas] Length = 851 Score = 67.0 bits (162), Expect = 5e-09 Identities = 28/44 (63%), Positives = 36/44 (81%) Frame = -1 Query: 397 WEDLLRKMLPEGAPLPDEDQLDYSISVDYVGPSPFFKPPNIDPM 266 WE++LRKMLP GAPLPDE+QLDYSI+V+Y GP + P +DP+ Sbjct: 13 WEEVLRKMLPAGAPLPDEEQLDYSIAVEYEGPPVPYDVPRVDPL 56 >ref|XP_007036953.1| Extra-large GTP-binding protein 3 [Theobroma cacao] gi|508774198|gb|EOY21454.1| Extra-large GTP-binding protein 3 [Theobroma cacao] Length = 864 Score = 66.6 bits (161), Expect = 7e-09 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = -1 Query: 397 WEDLLRKMLPEGAPLPDEDQLDYSISVDYVGPSPFFKPPNIDPM 266 WED++RKMLP GAPLPDED LDYSI+V+Y GP + P +DP+ Sbjct: 14 WEDVIRKMLPVGAPLPDEDHLDYSIAVEYEGPPIPYDVPRVDPL 57 >ref|XP_010936874.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like isoform X2 [Elaeis guineensis] Length = 804 Score = 66.2 bits (160), Expect = 9e-09 Identities = 29/48 (60%), Positives = 38/48 (79%) Frame = -1 Query: 397 WEDLLRKMLPEGAPLPDEDQLDYSISVDYVGPSPFFKPPNIDPMIPRS 254 WE+ LRKMLP GAPLPDE+ LDYSI+V+Y GP+ ++ P I+P+ RS Sbjct: 17 WEEALRKMLPPGAPLPDEEHLDYSIAVEYDGPAVSYEVPKIEPLDLRS 64 >ref|XP_010936873.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like isoform X1 [Elaeis guineensis] Length = 850 Score = 66.2 bits (160), Expect = 9e-09 Identities = 29/48 (60%), Positives = 38/48 (79%) Frame = -1 Query: 397 WEDLLRKMLPEGAPLPDEDQLDYSISVDYVGPSPFFKPPNIDPMIPRS 254 WE+ LRKMLP GAPLPDE+ LDYSI+V+Y GP+ ++ P I+P+ RS Sbjct: 17 WEEALRKMLPPGAPLPDEEHLDYSIAVEYDGPAVSYEVPKIEPLDLRS 64 >ref|XP_009355999.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like [Pyrus x bretschneideri] Length = 880 Score = 66.2 bits (160), Expect = 9e-09 Identities = 28/44 (63%), Positives = 35/44 (79%) Frame = -1 Query: 397 WEDLLRKMLPEGAPLPDEDQLDYSISVDYVGPSPFFKPPNIDPM 266 WEDLLRKMLP GAPLPDE+ LDYSI+++Y GP + P +DP+ Sbjct: 11 WEDLLRKMLPAGAPLPDEEHLDYSIAIEYEGPPLPYDLPEVDPV 54 >ref|XP_008776599.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like [Phoenix dactylifera] Length = 853 Score = 65.9 bits (159), Expect = 1e-08 Identities = 32/65 (49%), Positives = 42/65 (64%) Frame = -1 Query: 397 WEDLLRKMLPEGAPLPDEDQLDYSISVDYVGPSPFFKPPNIDPMIPRSRFTTFPKRVPSL 218 WE+ LRKMLP GAPLPDE+ LDYSI+V+Y GP ++ P I+P+ RS ++ Sbjct: 20 WEEALRKMLPPGAPLPDEEHLDYSIAVEYDGPPVPYEVPKIEPLDLRSASSSASAGDLPA 79 Query: 217 TPRNP 203 PR P Sbjct: 80 LPRGP 84 >ref|XP_006374248.1| hypothetical protein POPTR_0015s05370g [Populus trichocarpa] gi|550322005|gb|ERP52045.1| hypothetical protein POPTR_0015s05370g [Populus trichocarpa] Length = 793 Score = 65.9 bits (159), Expect = 1e-08 Identities = 25/44 (56%), Positives = 36/44 (81%) Frame = -1 Query: 397 WEDLLRKMLPEGAPLPDEDQLDYSISVDYVGPSPFFKPPNIDPM 266 WE+++R+MLP GAPLPDED LDYSI+++Y GP ++ P +DP+ Sbjct: 15 WEEVIRRMLPAGAPLPDEDHLDYSIAIEYEGPPVSYEVPRVDPL 58