BLASTX nr result
ID: Perilla23_contig00027614
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00027614 (436 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011098545.1| PREDICTED: paired amphipathic helix protein ... 64 4e-08 ref|XP_011098544.1| PREDICTED: paired amphipathic helix protein ... 64 4e-08 gb|EPS62222.1| hypothetical protein M569_12570, partial [Genlise... 56 9e-06 >ref|XP_011098545.1| PREDICTED: paired amphipathic helix protein Sin3-like 2 isoform X2 [Sesamum indicum] Length = 1379 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -3 Query: 212 MKRLRDDMIMNPQFKRPFGSSSSRGESYGPAQAP 111 MKRLRD++ MNPQFKRPFGSSSSRGESYGP+ P Sbjct: 1 MKRLRDEVYMNPQFKRPFGSSSSRGESYGPSHTP 34 >ref|XP_011098544.1| PREDICTED: paired amphipathic helix protein Sin3-like 2 isoform X1 [Sesamum indicum] Length = 1380 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -3 Query: 212 MKRLRDDMIMNPQFKRPFGSSSSRGESYGPAQAP 111 MKRLRD++ MNPQFKRPFGSSSSRGESYGP+ P Sbjct: 1 MKRLRDEVYMNPQFKRPFGSSSSRGESYGPSHTP 34 >gb|EPS62222.1| hypothetical protein M569_12570, partial [Genlisea aurea] Length = 454 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -3 Query: 215 EMKRLRDDMIMNPQFKRPFGSSSSRGESYGPAQAP 111 EMKRLRD++ +NPQFKRPF SS+ RGESY P Q P Sbjct: 1 EMKRLRDEVYLNPQFKRPFASSAYRGESYVPPQPP 35