BLASTX nr result
ID: Perilla23_contig00027594
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00027594 (401 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011081589.1| PREDICTED: fatty-acid-binding protein 2 [Ses... 64 6e-08 >ref|XP_011081589.1| PREDICTED: fatty-acid-binding protein 2 [Sesamum indicum] gi|747069581|ref|XP_011081590.1| PREDICTED: fatty-acid-binding protein 2 [Sesamum indicum] gi|747069583|ref|XP_011081591.1| PREDICTED: fatty-acid-binding protein 2 [Sesamum indicum] Length = 429 Score = 63.5 bits (153), Expect = 6e-08 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -3 Query: 90 MGNNWLFFVEPDGNTGGIFPIDPLLPHSLG 1 MGNNWLFF+EPDG++ GIFP+DPLLPHSLG Sbjct: 1 MGNNWLFFIEPDGSSSGIFPMDPLLPHSLG 30