BLASTX nr result
ID: Perilla23_contig00025871
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00025871 (369 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010530145.1| PREDICTED: transmembrane protein 18-like [Ta... 79 1e-12 ref|XP_012853533.1| PREDICTED: transmembrane protein 18 [Erythra... 78 3e-12 ref|XP_009772564.1| PREDICTED: transmembrane protein 18 [Nicotia... 77 4e-12 ref|XP_009606399.1| PREDICTED: transmembrane protein 18 [Nicotia... 77 4e-12 ref|XP_013674779.1| PREDICTED: transmembrane protein 18-like [Br... 77 7e-12 ref|XP_011074919.1| PREDICTED: transmembrane protein 18 [Sesamum... 77 7e-12 ref|XP_010478866.1| PREDICTED: transmembrane protein 18-like [Ca... 77 7e-12 ref|XP_010461263.1| PREDICTED: transmembrane protein 18-like [Ca... 77 7e-12 ref|XP_010499979.1| PREDICTED: transmembrane protein 18-like iso... 77 7e-12 ref|XP_006304269.1| hypothetical protein CARUB_v10010501mg [Caps... 77 7e-12 ref|XP_004290433.1| PREDICTED: transmembrane protein 18 [Fragari... 77 7e-12 gb|AFK35494.1| unknown [Lotus japonicus] gi|388496944|gb|AFK3653... 77 7e-12 ref|XP_002891098.1| hypothetical protein ARALYDRAFT_473588 [Arab... 77 7e-12 ref|XP_010094861.1| hypothetical protein L484_016443 [Morus nota... 76 9e-12 ref|XP_009375267.1| PREDICTED: transmembrane protein 18 [Pyrus x... 76 9e-12 ref|XP_008382008.1| PREDICTED: transmembrane protein 18-like [Ma... 76 9e-12 ref|XP_008381001.1| PREDICTED: transmembrane protein 18 [Malus d... 76 9e-12 ref|XP_003518332.1| PREDICTED: transmembrane protein 18-like [Gl... 76 9e-12 ref|NP_001237116.1| uncharacterized protein LOC100527513 [Glycin... 76 9e-12 ref|XP_009776007.1| PREDICTED: transmembrane protein 18-like, pa... 76 1e-11 >ref|XP_010530145.1| PREDICTED: transmembrane protein 18-like [Tarenaya hassleriana] Length = 203 Score = 79.0 bits (193), Expect = 1e-12 Identities = 36/43 (83%), Positives = 42/43 (97%) Frame = -2 Query: 368 SGPLLVIAIIILVNTLFSLCHMIVKWKRAELKHRARTARSKED 240 SGPLLVIA+IIL+NTLFSLCH+IVKWKRAEL+HRAR ARSK++ Sbjct: 161 SGPLLVIAMIILINTLFSLCHLIVKWKRAELRHRARLARSKQE 203 >ref|XP_012853533.1| PREDICTED: transmembrane protein 18 [Erythranthe guttatus] gi|604304693|gb|EYU23944.1| hypothetical protein MIMGU_mgv1a015262mg [Erythranthe guttata] Length = 163 Score = 77.8 bits (190), Expect = 3e-12 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -2 Query: 368 SGPLLVIAIIILVNTLFSLCHMIVKWKRAELKHRARTARSKED 240 SGPLLVIAIIILVNTLFS+CH++V+WK+AELKHRAR ARSK D Sbjct: 121 SGPLLVIAIIILVNTLFSMCHLMVRWKKAELKHRARVARSKVD 163 >ref|XP_009772564.1| PREDICTED: transmembrane protein 18 [Nicotiana sylvestris] Length = 163 Score = 77.4 bits (189), Expect = 4e-12 Identities = 36/43 (83%), Positives = 42/43 (97%) Frame = -2 Query: 368 SGPLLVIAIIILVNTLFSLCHMIVKWKRAELKHRARTARSKED 240 SGPLLVIAIIILVNTLFSLC++IV+WK+AEL+HRAR AR+KED Sbjct: 121 SGPLLVIAIIILVNTLFSLCYLIVRWKKAELRHRARLARNKED 163 >ref|XP_009606399.1| PREDICTED: transmembrane protein 18 [Nicotiana tomentosiformis] Length = 163 Score = 77.4 bits (189), Expect = 4e-12 Identities = 36/43 (83%), Positives = 42/43 (97%) Frame = -2 Query: 368 SGPLLVIAIIILVNTLFSLCHMIVKWKRAELKHRARTARSKED 240 SGPLLVIAIIILVNTLFSLC++IV+WK+AEL+HRAR AR+KED Sbjct: 121 SGPLLVIAIIILVNTLFSLCYLIVRWKKAELRHRARLARNKED 163 >ref|XP_013674779.1| PREDICTED: transmembrane protein 18-like [Brassica napus] Length = 163 Score = 76.6 bits (187), Expect = 7e-12 Identities = 35/43 (81%), Positives = 42/43 (97%) Frame = -2 Query: 368 SGPLLVIAIIILVNTLFSLCHMIVKWKRAELKHRARTARSKED 240 SGPLLVIA+IIL+NTLFSLC++IVKWKRAEL+HRAR ARSK++ Sbjct: 121 SGPLLVIAMIILINTLFSLCYLIVKWKRAELRHRARLARSKQE 163 >ref|XP_011074919.1| PREDICTED: transmembrane protein 18 [Sesamum indicum] Length = 163 Score = 76.6 bits (187), Expect = 7e-12 Identities = 35/43 (81%), Positives = 41/43 (95%) Frame = -2 Query: 368 SGPLLVIAIIILVNTLFSLCHMIVKWKRAELKHRARTARSKED 240 SGPLLVIAIIILVNTLFSLCH+IV+WK+AEL+HRAR A+ KE+ Sbjct: 121 SGPLLVIAIIILVNTLFSLCHLIVRWKKAELRHRARVAQKKEE 163 >ref|XP_010478866.1| PREDICTED: transmembrane protein 18-like [Camelina sativa] gi|727611465|ref|XP_010478867.1| PREDICTED: transmembrane protein 18-like [Camelina sativa] Length = 163 Score = 76.6 bits (187), Expect = 7e-12 Identities = 35/43 (81%), Positives = 42/43 (97%) Frame = -2 Query: 368 SGPLLVIAIIILVNTLFSLCHMIVKWKRAELKHRARTARSKED 240 SGPLLVIA+IIL+NTLFSLC++IVKWKRAEL+HRAR AR+KE+ Sbjct: 121 SGPLLVIAMIILINTLFSLCYLIVKWKRAELRHRARLARTKEE 163 >ref|XP_010461263.1| PREDICTED: transmembrane protein 18-like [Camelina sativa] Length = 163 Score = 76.6 bits (187), Expect = 7e-12 Identities = 35/43 (81%), Positives = 42/43 (97%) Frame = -2 Query: 368 SGPLLVIAIIILVNTLFSLCHMIVKWKRAELKHRARTARSKED 240 SGPLLVIA+IIL+NTLFSLC++IVKWKRAEL+HRAR AR+KE+ Sbjct: 121 SGPLLVIAMIILINTLFSLCYLIVKWKRAELRHRARLARTKEE 163 >ref|XP_010499979.1| PREDICTED: transmembrane protein 18-like isoform X1 [Camelina sativa] gi|727437317|ref|XP_010499980.1| PREDICTED: transmembrane protein 18-like isoform X2 [Camelina sativa] Length = 163 Score = 76.6 bits (187), Expect = 7e-12 Identities = 35/43 (81%), Positives = 42/43 (97%) Frame = -2 Query: 368 SGPLLVIAIIILVNTLFSLCHMIVKWKRAELKHRARTARSKED 240 SGPLLVIA+IIL+NTLFSLC++IVKWKRAEL+HRAR AR+KE+ Sbjct: 121 SGPLLVIAMIILINTLFSLCYLIVKWKRAELRHRARLARTKEE 163 >ref|XP_006304269.1| hypothetical protein CARUB_v10010501mg [Capsella rubella] gi|482572980|gb|EOA37167.1| hypothetical protein CARUB_v10010501mg [Capsella rubella] Length = 163 Score = 76.6 bits (187), Expect = 7e-12 Identities = 35/43 (81%), Positives = 42/43 (97%) Frame = -2 Query: 368 SGPLLVIAIIILVNTLFSLCHMIVKWKRAELKHRARTARSKED 240 SGPLLVIA+IIL+NTLFSLC++IVKWKRAEL+HRAR AR+KE+ Sbjct: 121 SGPLLVIAMIILINTLFSLCYLIVKWKRAELRHRARLARAKEE 163 >ref|XP_004290433.1| PREDICTED: transmembrane protein 18 [Fragaria vesca subsp. vesca] Length = 163 Score = 76.6 bits (187), Expect = 7e-12 Identities = 34/43 (79%), Positives = 42/43 (97%) Frame = -2 Query: 368 SGPLLVIAIIILVNTLFSLCHMIVKWKRAELKHRARTARSKED 240 SGPLLVIAIIIL+NTLFSLCH+IVKWK+AEL+HRAR +++K+D Sbjct: 121 SGPLLVIAIIILINTLFSLCHLIVKWKKAELRHRARLSQNKQD 163 >gb|AFK35494.1| unknown [Lotus japonicus] gi|388496944|gb|AFK36538.1| unknown [Lotus japonicus] Length = 163 Score = 76.6 bits (187), Expect = 7e-12 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -2 Query: 368 SGPLLVIAIIILVNTLFSLCHMIVKWKRAELKHRARTARSKED 240 SGPLLVIA+IILVNTLFSLC++IVKWKRAEL+HRAR A SK+D Sbjct: 121 SGPLLVIAMIILVNTLFSLCYLIVKWKRAELRHRARAASSKQD 163 >ref|XP_002891098.1| hypothetical protein ARALYDRAFT_473588 [Arabidopsis lyrata subsp. lyrata] gi|297336940|gb|EFH67357.1| hypothetical protein ARALYDRAFT_473588 [Arabidopsis lyrata subsp. lyrata] Length = 163 Score = 76.6 bits (187), Expect = 7e-12 Identities = 35/43 (81%), Positives = 42/43 (97%) Frame = -2 Query: 368 SGPLLVIAIIILVNTLFSLCHMIVKWKRAELKHRARTARSKED 240 SGPLLVIA+IIL+NTLFSLC++IVKWKRAEL+HRAR AR+KE+ Sbjct: 121 SGPLLVIAMIILINTLFSLCYLIVKWKRAELRHRARLARTKEE 163 >ref|XP_010094861.1| hypothetical protein L484_016443 [Morus notabilis] gi|587868017|gb|EXB57390.1| hypothetical protein L484_016443 [Morus notabilis] Length = 202 Score = 76.3 bits (186), Expect = 9e-12 Identities = 34/43 (79%), Positives = 41/43 (95%) Frame = -2 Query: 368 SGPLLVIAIIILVNTLFSLCHMIVKWKRAELKHRARTARSKED 240 SGPLL IAIIIL+NTLFSLCH+IV+WK+AEL+HRAR AR+K+D Sbjct: 160 SGPLLFIAIIILINTLFSLCHLIVRWKKAELRHRARLARNKQD 202 >ref|XP_009375267.1| PREDICTED: transmembrane protein 18 [Pyrus x bretschneideri] Length = 163 Score = 76.3 bits (186), Expect = 9e-12 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -2 Query: 368 SGPLLVIAIIILVNTLFSLCHMIVKWKRAELKHRARTARSKED 240 SGPLLVIAIIILVNTLFSLC +IVKWKRAEL+HRAR ++SK+D Sbjct: 121 SGPLLVIAIIILVNTLFSLCRLIVKWKRAELRHRARLSQSKQD 163 >ref|XP_008382008.1| PREDICTED: transmembrane protein 18-like [Malus domestica] Length = 163 Score = 76.3 bits (186), Expect = 9e-12 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -2 Query: 368 SGPLLVIAIIILVNTLFSLCHMIVKWKRAELKHRARTARSKED 240 SGPLLVIAIIILVNTLFSLC +IVKWKRAEL+HRAR ++SK+D Sbjct: 121 SGPLLVIAIIILVNTLFSLCRLIVKWKRAELRHRARLSQSKQD 163 >ref|XP_008381001.1| PREDICTED: transmembrane protein 18 [Malus domestica] Length = 163 Score = 76.3 bits (186), Expect = 9e-12 Identities = 36/43 (83%), Positives = 41/43 (95%) Frame = -2 Query: 368 SGPLLVIAIIILVNTLFSLCHMIVKWKRAELKHRARTARSKED 240 SGPLLVIAIIILVNTLFSLC +IVKWKRAEL+HRAR ++SK+D Sbjct: 121 SGPLLVIAIIILVNTLFSLCRLIVKWKRAELRHRARLSQSKQD 163 >ref|XP_003518332.1| PREDICTED: transmembrane protein 18-like [Glycine max] gi|734312521|gb|KHN00699.1| Transmembrane protein 18 [Glycine soja] gi|947121994|gb|KRH70200.1| hypothetical protein GLYMA_02G074600 [Glycine max] Length = 163 Score = 76.3 bits (186), Expect = 9e-12 Identities = 34/43 (79%), Positives = 42/43 (97%) Frame = -2 Query: 368 SGPLLVIAIIILVNTLFSLCHMIVKWKRAELKHRARTARSKED 240 SGPLLVI++IIL+NTLFSLC+MIV+WKRAEL+HRAR AR+K+D Sbjct: 121 SGPLLVISMIILINTLFSLCYMIVRWKRAELRHRARAARNKQD 163 >ref|NP_001237116.1| uncharacterized protein LOC100527513 [Glycine max] gi|255632518|gb|ACU16609.1| unknown [Glycine max] gi|734404025|gb|KHN32796.1| Transmembrane protein 18 [Glycine soja] gi|947059148|gb|KRH08554.1| hypothetical protein GLYMA_16G156600 [Glycine max] Length = 163 Score = 76.3 bits (186), Expect = 9e-12 Identities = 34/43 (79%), Positives = 42/43 (97%) Frame = -2 Query: 368 SGPLLVIAIIILVNTLFSLCHMIVKWKRAELKHRARTARSKED 240 SGPLLVI++IIL+NTLFSLC+MIV+WKRAEL+HRAR AR+K+D Sbjct: 121 SGPLLVISMIILINTLFSLCYMIVRWKRAELRHRARAARNKQD 163 >ref|XP_009776007.1| PREDICTED: transmembrane protein 18-like, partial [Nicotiana sylvestris] Length = 86 Score = 75.9 bits (185), Expect = 1e-11 Identities = 35/42 (83%), Positives = 41/42 (97%) Frame = -2 Query: 365 GPLLVIAIIILVNTLFSLCHMIVKWKRAELKHRARTARSKED 240 GPLLVIAIIILVNTLFSLC++IV+WK+AEL+HRAR AR+KED Sbjct: 45 GPLLVIAIIILVNTLFSLCYLIVRWKKAELRHRARLARNKED 86