BLASTX nr result
ID: Perilla23_contig00025671
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00025671 (835 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACI31202.1| TRX [Salvia miltiorrhiza] 79 5e-12 emb|CAH59450.1| thioredoxin 1 [Plantago major] 77 2e-11 gb|AJO53737.1| thioredoxin H-type 1, partial [Avicennia alba] gi... 76 3e-11 ref|XP_006341987.1| PREDICTED: thioredoxin H-type 1-like [Solanu... 76 3e-11 gb|AGW24487.1| thioredoxin H-type 1, partial [Avicennia marina v... 76 3e-11 ref|XP_012842781.1| PREDICTED: thioredoxin H-type 1 [Erythranthe... 76 3e-11 ref|XP_009761049.1| PREDICTED: thioredoxin H-type 1 [Nicotiana s... 76 3e-11 gb|EYU32886.1| hypothetical protein MIMGU_mgv1a015367mg [Erythra... 76 3e-11 ref|XP_004499205.1| PREDICTED: thioredoxin H-type 1-like [Cicer ... 76 3e-11 gb|AJO53738.1| thioredoxin H-type 1, partial [Avicennia germinans] 75 4e-11 ref|XP_011083608.1| PREDICTED: thioredoxin H-type-like [Sesamum ... 75 4e-11 ref|XP_009603030.1| PREDICTED: thioredoxin H-type 1 [Nicotiana t... 75 8e-11 ref|XP_011074624.1| PREDICTED: thioredoxin H-type 1-like [Sesamu... 75 8e-11 gb|AAR83852.1| thioredoxin [Capsicum annuum] gi|125489263|gb|ABN... 75 8e-11 gb|KOM49108.1| hypothetical protein LR48_Vigan07g281200 [Vigna a... 74 1e-10 gb|AFP49340.1| thioredoxin h [Olea europaea] 74 1e-10 gb|ACV52592.1| thioredoxin H-type 1, partial [Nicotiana benthami... 74 1e-10 emb|CDP07462.1| unnamed protein product [Coffea canephora] 74 1e-10 gb|AAQ23134.1| thioredoxin H1 [Ipomoea batatas] 74 2e-10 ref|XP_004238306.1| PREDICTED: thioredoxin H-type 1 [Solanum lyc... 73 3e-10 >gb|ACI31202.1| TRX [Salvia miltiorrhiza] Length = 122 Score = 78.6 bits (192), Expect = 5e-12 Identities = 38/46 (82%), Positives = 39/46 (84%) Frame = -3 Query: 380 VVVDFIASLCGPCHFIAPIFAEIAKKTPHVIFLKVDVDELKVLYYE 243 VVVDF AS CGPC FIAPI AEIAKKTPHVIFLKVDVDELK + E Sbjct: 32 VVVDFTASWCGPCRFIAPILAEIAKKTPHVIFLKVDVDELKTVAQE 77 >emb|CAH59450.1| thioredoxin 1 [Plantago major] Length = 119 Score = 76.6 bits (187), Expect = 2e-11 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = -3 Query: 380 VVVDFIASLCGPCHFIAPIFAEIAKKTPHVIFLKVDVDELKVLYYE 243 VV+DF AS CGPC FIAPI AE+AKKTPHV+FLKVDVDELK + E Sbjct: 33 VVIDFTASWCGPCRFIAPILAELAKKTPHVMFLKVDVDELKAISVE 78 >gb|AJO53737.1| thioredoxin H-type 1, partial [Avicennia alba] gi|757951965|gb|AJO53739.1| thioredoxin H-type 1, partial [Avicennia marina subsp. eucalyptifolia] gi|757951967|gb|AJO53740.1| thioredoxin H-type 1, partial [Avicennia marina var. marina] gi|757951969|gb|AJO53741.1| thioredoxin H-type 1, partial [Avicennia officinalis] gi|757951971|gb|AJO53742.1| thioredoxin H-type 1, partial [Avicennia rumphiana] Length = 53 Score = 76.3 bits (186), Expect = 3e-11 Identities = 36/46 (78%), Positives = 39/46 (84%) Frame = -3 Query: 380 VVVDFIASLCGPCHFIAPIFAEIAKKTPHVIFLKVDVDELKVLYYE 243 VVVDF AS CGPC FIAPI AEIAKK+PHV+FLKVDVDELK + E Sbjct: 1 VVVDFTASWCGPCRFIAPILAEIAKKSPHVVFLKVDVDELKTVATE 46 >ref|XP_006341987.1| PREDICTED: thioredoxin H-type 1-like [Solanum tuberosum] Length = 123 Score = 76.3 bits (186), Expect = 3e-11 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = -3 Query: 380 VVVDFIASLCGPCHFIAPIFAEIAKKTPHVIFLKVDVDELK 258 VVVDF AS CGPC FI+PI AEIAKKTPHVIFLKVDVDELK Sbjct: 33 VVVDFTASWCGPCRFISPILAEIAKKTPHVIFLKVDVDELK 73 >gb|AGW24487.1| thioredoxin H-type 1, partial [Avicennia marina var. marina] Length = 70 Score = 76.3 bits (186), Expect = 3e-11 Identities = 36/46 (78%), Positives = 39/46 (84%) Frame = -3 Query: 380 VVVDFIASLCGPCHFIAPIFAEIAKKTPHVIFLKVDVDELKVLYYE 243 VVVDF AS CGPC FIAPI AEIAKK+PHV+FLKVDVDELK + E Sbjct: 1 VVVDFTASWCGPCRFIAPILAEIAKKSPHVVFLKVDVDELKTVATE 46 >ref|XP_012842781.1| PREDICTED: thioredoxin H-type 1 [Erythranthe guttatus] Length = 119 Score = 75.9 bits (185), Expect = 3e-11 Identities = 36/41 (87%), Positives = 36/41 (87%) Frame = -3 Query: 380 VVVDFIASLCGPCHFIAPIFAEIAKKTPHVIFLKVDVDELK 258 VVVDF AS CGPC FIAPI AEIAKKTPH IFLKVDVDELK Sbjct: 33 VVVDFTASWCGPCRFIAPILAEIAKKTPHAIFLKVDVDELK 73 >ref|XP_009761049.1| PREDICTED: thioredoxin H-type 1 [Nicotiana sylvestris] Length = 123 Score = 75.9 bits (185), Expect = 3e-11 Identities = 37/46 (80%), Positives = 38/46 (82%) Frame = -3 Query: 380 VVVDFIASLCGPCHFIAPIFAEIAKKTPHVIFLKVDVDELKVLYYE 243 VVVDF AS CGPC FIAPI AEIAKK PHVIFLKVDVDELK + E Sbjct: 34 VVVDFTASWCGPCRFIAPILAEIAKKMPHVIFLKVDVDELKTVAEE 79 >gb|EYU32886.1| hypothetical protein MIMGU_mgv1a015367mg [Erythranthe guttata] Length = 160 Score = 75.9 bits (185), Expect = 3e-11 Identities = 36/41 (87%), Positives = 36/41 (87%) Frame = -3 Query: 380 VVVDFIASLCGPCHFIAPIFAEIAKKTPHVIFLKVDVDELK 258 VVVDF AS CGPC FIAPI AEIAKKTPH IFLKVDVDELK Sbjct: 74 VVVDFTASWCGPCRFIAPILAEIAKKTPHAIFLKVDVDELK 114 >ref|XP_004499205.1| PREDICTED: thioredoxin H-type 1-like [Cicer arietinum] Length = 120 Score = 75.9 bits (185), Expect = 3e-11 Identities = 36/46 (78%), Positives = 38/46 (82%) Frame = -3 Query: 380 VVVDFIASLCGPCHFIAPIFAEIAKKTPHVIFLKVDVDELKVLYYE 243 +VVDF AS CGPC FIAPI AEIAK TPHVIFLKVDVDELK + E Sbjct: 31 IVVDFTASWCGPCRFIAPILAEIAKNTPHVIFLKVDVDELKTVAEE 76 >gb|AJO53738.1| thioredoxin H-type 1, partial [Avicennia germinans] Length = 53 Score = 75.5 bits (184), Expect = 4e-11 Identities = 37/46 (80%), Positives = 39/46 (84%) Frame = -3 Query: 380 VVVDFIASLCGPCHFIAPIFAEIAKKTPHVIFLKVDVDELKVLYYE 243 VVVDF AS CGPC FIAPI AEIAKKTP+VIFLKVDVDELK + E Sbjct: 1 VVVDFTASWCGPCRFIAPILAEIAKKTPNVIFLKVDVDELKTVAAE 46 >ref|XP_011083608.1| PREDICTED: thioredoxin H-type-like [Sesamum indicum] Length = 119 Score = 75.5 bits (184), Expect = 4e-11 Identities = 36/46 (78%), Positives = 39/46 (84%) Frame = -3 Query: 380 VVVDFIASLCGPCHFIAPIFAEIAKKTPHVIFLKVDVDELKVLYYE 243 VVVDF AS CGPC FIAPI AEIAK+TPHV+FLKVDVDELK + E Sbjct: 31 VVVDFTASWCGPCRFIAPILAEIAKRTPHVMFLKVDVDELKSVAQE 76 >ref|XP_009603030.1| PREDICTED: thioredoxin H-type 1 [Nicotiana tomentosiformis] gi|267124|sp|P29449.1|TRXH1_TOBAC RecName: Full=Thioredoxin H-type 1; Short=Trx-H1 gi|20047|emb|CAA41415.1| thioredoxin [Nicotiana tabacum] Length = 126 Score = 74.7 bits (182), Expect = 8e-11 Identities = 36/46 (78%), Positives = 38/46 (82%) Frame = -3 Query: 380 VVVDFIASLCGPCHFIAPIFAEIAKKTPHVIFLKVDVDELKVLYYE 243 VVVDF AS CGPC FIAPI A+IAKK PHVIFLKVDVDELK + E Sbjct: 37 VVVDFTASWCGPCRFIAPILADIAKKMPHVIFLKVDVDELKTVSAE 82 >ref|XP_011074624.1| PREDICTED: thioredoxin H-type 1-like [Sesamum indicum] Length = 120 Score = 74.7 bits (182), Expect = 8e-11 Identities = 36/43 (83%), Positives = 37/43 (86%) Frame = -3 Query: 380 VVVDFIASLCGPCHFIAPIFAEIAKKTPHVIFLKVDVDELKVL 252 VVVDF AS CGPC FIAPI AEIAKKT HVIFLKVDVDELK + Sbjct: 32 VVVDFTASWCGPCRFIAPILAEIAKKTTHVIFLKVDVDELKTV 74 >gb|AAR83852.1| thioredoxin [Capsicum annuum] gi|125489263|gb|ABN42904.1| thioredoxin H-type [Capsicum annuum] Length = 124 Score = 74.7 bits (182), Expect = 8e-11 Identities = 36/46 (78%), Positives = 38/46 (82%) Frame = -3 Query: 380 VVVDFIASLCGPCHFIAPIFAEIAKKTPHVIFLKVDVDELKVLYYE 243 VVVDF AS CGPC FIAPI A+IAKK PHVIFLKVDVDELK + E Sbjct: 34 VVVDFTASWCGPCRFIAPILADIAKKMPHVIFLKVDVDELKTVAEE 79 >gb|KOM49108.1| hypothetical protein LR48_Vigan07g281200 [Vigna angularis] Length = 148 Score = 74.3 bits (181), Expect = 1e-10 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = -3 Query: 380 VVVDFIASLCGPCHFIAPIFAEIAKKTPHVIFLKVDVDEL 261 VVVDF AS CGPC F+API AEIAKKTPHVIFLKVDVDEL Sbjct: 55 VVVDFTASWCGPCRFMAPILAEIAKKTPHVIFLKVDVDEL 94 >gb|AFP49340.1| thioredoxin h [Olea europaea] Length = 123 Score = 74.3 bits (181), Expect = 1e-10 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = -3 Query: 380 VVVDFIASLCGPCHFIAPIFAEIAKKTPHVIFLKVDVDELK 258 VV+DF AS CGPC IAPI AEIAKKTPHVIFLKVDVDELK Sbjct: 31 VVIDFTASWCGPCRVIAPILAEIAKKTPHVIFLKVDVDELK 71 >gb|ACV52592.1| thioredoxin H-type 1, partial [Nicotiana benthamiana] Length = 119 Score = 74.3 bits (181), Expect = 1e-10 Identities = 35/46 (76%), Positives = 38/46 (82%) Frame = -3 Query: 380 VVVDFIASLCGPCHFIAPIFAEIAKKTPHVIFLKVDVDELKVLYYE 243 VVVDF AS CGPC FIAP+ A+IAKK PHVIFLKVDVDELK + E Sbjct: 30 VVVDFTASWCGPCRFIAPVLADIAKKMPHVIFLKVDVDELKTVAEE 75 >emb|CDP07462.1| unnamed protein product [Coffea canephora] Length = 132 Score = 73.9 bits (180), Expect = 1e-10 Identities = 35/43 (81%), Positives = 36/43 (83%) Frame = -3 Query: 380 VVVDFIASLCGPCHFIAPIFAEIAKKTPHVIFLKVDVDELKVL 252 VVVDF AS CGPC FIAPI AE AKK PHVIFLKVDVDELK + Sbjct: 31 VVVDFTASWCGPCRFIAPILAEFAKKLPHVIFLKVDVDELKTV 73 >gb|AAQ23134.1| thioredoxin H1 [Ipomoea batatas] Length = 108 Score = 73.6 bits (179), Expect = 2e-10 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = -3 Query: 377 VVDFIASLCGPCHFIAPIFAEIAKKTPHVIFLKVDVDELK 258 VVDF AS CGPC FIAPI A++AKKTPHVIFLKVDVDELK Sbjct: 32 VVDFTASWCGPCRFIAPILADMAKKTPHVIFLKVDVDELK 71 >ref|XP_004238306.1| PREDICTED: thioredoxin H-type 1 [Solanum lycopersicum] Length = 123 Score = 72.8 bits (177), Expect = 3e-10 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -3 Query: 380 VVVDFIASLCGPCHFIAPIFAEIAKKTPHVIFLKVDVDELK 258 VVVDF AS CGPC FIAPI A+IAKK PHV+FLKVDVDELK Sbjct: 33 VVVDFTASWCGPCRFIAPILADIAKKMPHVMFLKVDVDELK 73