BLASTX nr result
ID: Perilla23_contig00025276
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00025276 (358 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012835789.1| PREDICTED: DELLA protein RGL1-like [Erythran... 68 3e-09 gb|EYU38429.1| hypothetical protein MIMGU_mgv1a026015mg [Erythra... 68 3e-09 ref|XP_011082627.1| PREDICTED: DELLA protein RGL1-like [Sesamum ... 64 6e-08 ref|XP_010321870.1| PREDICTED: DELLA protein GAI1-like [Solanum ... 64 6e-08 ref|XP_006355859.1| PREDICTED: DELLA protein GAIP-like [Solanum ... 64 6e-08 ref|XP_012082904.1| PREDICTED: DELLA protein GAIP-like [Jatropha... 62 2e-07 ref|XP_009784435.1| PREDICTED: DELLA protein GAI1-like [Nicotian... 62 2e-07 emb|CDP14979.1| unnamed protein product [Coffea canephora] 62 2e-07 gb|KDP28264.1| hypothetical protein JCGZ_14035 [Jatropha curcas] 62 2e-07 ref|XP_010652534.1| PREDICTED: DELLA protein RGL1-like [Vitis vi... 60 5e-07 ref|XP_009772108.1| PREDICTED: scarecrow-like protein 18 [Nicoti... 60 5e-07 emb|CBI36955.3| unnamed protein product [Vitis vinifera] 60 5e-07 emb|CDO98775.1| unnamed protein product [Coffea canephora] 60 6e-07 ref|XP_002515278.1| DELLA protein RGL2, putative [Ricinus commun... 60 6e-07 ref|XP_010322387.1| PREDICTED: DELLA protein RGL1-like [Solanum ... 60 8e-07 ref|XP_009616214.1| PREDICTED: DELLA protein RGL1-like [Nicotian... 59 2e-06 ref|XP_009628660.1| PREDICTED: DELLA protein RGL1-like [Nicotian... 58 2e-06 ref|XP_009378753.1| PREDICTED: DELLA protein RGL1-like [Pyrus x ... 58 2e-06 ref|XP_010087232.1| hypothetical protein L484_009741 [Morus nota... 57 4e-06 ref|XP_012846595.1| PREDICTED: DELLA protein RGL3-like [Erythran... 57 4e-06 >ref|XP_012835789.1| PREDICTED: DELLA protein RGL1-like [Erythranthe guttatus] Length = 554 Score = 67.8 bits (164), Expect = 3e-09 Identities = 35/59 (59%), Positives = 40/59 (67%), Gaps = 10/59 (16%) Frame = +3 Query: 12 YTRKCQIQIQLSESAKYQASLVLEQF----------DGKALIVGWKGTPIQSLTAWKFS 158 +TR ++ +LSESAKYQASLVL +F DGK LIVGWKGTP SLTAW FS Sbjct: 492 FTRFGMVETELSESAKYQASLVLNKFAHGSSCTLECDGKGLIVGWKGTPFHSLTAWNFS 550 >gb|EYU38429.1| hypothetical protein MIMGU_mgv1a026015mg [Erythranthe guttata] Length = 624 Score = 67.8 bits (164), Expect = 3e-09 Identities = 35/59 (59%), Positives = 40/59 (67%), Gaps = 10/59 (16%) Frame = +3 Query: 12 YTRKCQIQIQLSESAKYQASLVLEQF----------DGKALIVGWKGTPIQSLTAWKFS 158 +TR ++ +LSESAKYQASLVL +F DGK LIVGWKGTP SLTAW FS Sbjct: 562 FTRFGMVETELSESAKYQASLVLNKFAHGSSCTLECDGKGLIVGWKGTPFHSLTAWNFS 620 >ref|XP_011082627.1| PREDICTED: DELLA protein RGL1-like [Sesamum indicum] Length = 601 Score = 63.5 bits (153), Expect = 6e-08 Identities = 32/59 (54%), Positives = 41/59 (69%), Gaps = 10/59 (16%) Frame = +3 Query: 12 YTRKCQIQIQLSESAKYQASLVLEQF----------DGKALIVGWKGTPIQSLTAWKFS 158 + R I+I+LS+S++YQASL L+QF +GK L VGWKGTP+ SLTAWKFS Sbjct: 543 FMRFGMIEIELSDSSRYQASLTLKQFAQGNSCTLESNGKGLTVGWKGTPLHSLTAWKFS 601 >ref|XP_010321870.1| PREDICTED: DELLA protein GAI1-like [Solanum lycopersicum] Length = 278 Score = 63.5 bits (153), Expect = 6e-08 Identities = 29/58 (50%), Positives = 43/58 (74%), Gaps = 10/58 (17%) Frame = +3 Query: 12 YTRKCQIQIQLSESAKYQASLVLEQF----------DGKALIVGWKGTPIQSLTAWKF 155 + R ++++LSES++YQA+L+L+QF DGKAL+VGWKGTPI+S++ WKF Sbjct: 220 FARFGMVEMELSESSRYQANLILKQFSHGSSCIVQKDGKALLVGWKGTPIESVSIWKF 277 >ref|XP_006355859.1| PREDICTED: DELLA protein GAIP-like [Solanum tuberosum] Length = 584 Score = 63.5 bits (153), Expect = 6e-08 Identities = 29/58 (50%), Positives = 43/58 (74%), Gaps = 10/58 (17%) Frame = +3 Query: 12 YTRKCQIQIQLSESAKYQASLVLEQF----------DGKALIVGWKGTPIQSLTAWKF 155 + R ++++LSES++YQA+L+L+QF DGKAL+VGWKGTPI+S++ WKF Sbjct: 526 FVRFGMVEMELSESSRYQANLILKQFSHGSSCIVQNDGKALLVGWKGTPIESVSIWKF 583 >ref|XP_012082904.1| PREDICTED: DELLA protein GAIP-like [Jatropha curcas] Length = 442 Score = 61.6 bits (148), Expect = 2e-07 Identities = 31/59 (52%), Positives = 41/59 (69%), Gaps = 10/59 (16%) Frame = +3 Query: 12 YTRKCQIQIQLSESAKYQASLVLEQF----------DGKALIVGWKGTPIQSLTAWKFS 158 +TR ++I SES+ YQASLVL+Q+ +GK LI+GWKGTP+ SL+AWKFS Sbjct: 371 FTRFKMVEIGFSESSLYQASLVLKQYPCGSSCTLDKNGKCLILGWKGTPLHSLSAWKFS 429 >ref|XP_009784435.1| PREDICTED: DELLA protein GAI1-like [Nicotiana sylvestris] Length = 278 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/58 (50%), Positives = 42/58 (72%), Gaps = 10/58 (17%) Frame = +3 Query: 12 YTRKCQIQIQLSESAKYQASLVLEQF----------DGKALIVGWKGTPIQSLTAWKF 155 + R ++++LSES+ YQA+L+L+QF DGKAL+VGWKGTPI+S++ WKF Sbjct: 220 FARFGMVEMELSESSWYQANLILKQFSQGSSCNVQNDGKALLVGWKGTPIESVSIWKF 277 >emb|CDP14979.1| unnamed protein product [Coffea canephora] Length = 510 Score = 61.6 bits (148), Expect = 2e-07 Identities = 30/52 (57%), Positives = 37/52 (71%), Gaps = 10/52 (19%) Frame = +3 Query: 30 IQIQLSESAKYQASLVLEQF----------DGKALIVGWKGTPIQSLTAWKF 155 +Q++LS S+ YQASLVL+ F DGK LI+GWKGTPI SL+AWKF Sbjct: 439 VQVELSMSSMYQASLVLKNFECGSSCTLNKDGKGLIIGWKGTPIHSLSAWKF 490 >gb|KDP28264.1| hypothetical protein JCGZ_14035 [Jatropha curcas] Length = 279 Score = 61.6 bits (148), Expect = 2e-07 Identities = 31/59 (52%), Positives = 41/59 (69%), Gaps = 10/59 (16%) Frame = +3 Query: 12 YTRKCQIQIQLSESAKYQASLVLEQF----------DGKALIVGWKGTPIQSLTAWKFS 158 +TR ++I SES+ YQASLVL+Q+ +GK LI+GWKGTP+ SL+AWKFS Sbjct: 208 FTRFKMVEIGFSESSLYQASLVLKQYPCGSSCTLDKNGKCLILGWKGTPLHSLSAWKFS 266 >ref|XP_010652534.1| PREDICTED: DELLA protein RGL1-like [Vitis vinifera] Length = 604 Score = 60.5 bits (145), Expect = 5e-07 Identities = 28/59 (47%), Positives = 42/59 (71%), Gaps = 10/59 (16%) Frame = +3 Query: 12 YTRKCQIQIQLSESAKYQASLVLEQF----------DGKALIVGWKGTPIQSLTAWKFS 158 ++R ++++ SE++ YQASL++++F DGK LIVGWKGTPI SL+AWKF+ Sbjct: 546 FSRFGMVEMEFSEASLYQASLIIKRFACGSCCSLEKDGKCLIVGWKGTPIHSLSAWKFT 604 >ref|XP_009772108.1| PREDICTED: scarecrow-like protein 18 [Nicotiana sylvestris] Length = 583 Score = 60.5 bits (145), Expect = 5e-07 Identities = 30/58 (51%), Positives = 39/58 (67%), Gaps = 10/58 (17%) Frame = +3 Query: 12 YTRKCQIQIQLSESAKYQASLVLEQF----------DGKALIVGWKGTPIQSLTAWKF 155 + R ++ +LSESA YQA+L+L+QF DGK LI+GWKGTPI SL+ WKF Sbjct: 525 FARFGMVEEELSESAWYQANLILKQFAQGSCCNIHKDGKGLIIGWKGTPIHSLSIWKF 582 >emb|CBI36955.3| unnamed protein product [Vitis vinifera] Length = 582 Score = 60.5 bits (145), Expect = 5e-07 Identities = 28/59 (47%), Positives = 42/59 (71%), Gaps = 10/59 (16%) Frame = +3 Query: 12 YTRKCQIQIQLSESAKYQASLVLEQF----------DGKALIVGWKGTPIQSLTAWKFS 158 ++R ++++ SE++ YQASL++++F DGK LIVGWKGTPI SL+AWKF+ Sbjct: 524 FSRFGMVEMEFSEASLYQASLIIKRFACGSCCSLEKDGKCLIVGWKGTPIHSLSAWKFT 582 >emb|CDO98775.1| unnamed protein product [Coffea canephora] Length = 595 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 10/58 (17%) Frame = +3 Query: 12 YTRKCQIQIQLSESAKYQASLVLEQFD----------GKALIVGWKGTPIQSLTAWKF 155 + R +Q++LS S+ YQA+L+L+ FD GK LI+GWKGTPI SL+AWKF Sbjct: 537 FARFGMVQVELSMSSMYQANLLLKNFDCGSSCTLAMDGKGLIIGWKGTPIHSLSAWKF 594 >ref|XP_002515278.1| DELLA protein RGL2, putative [Ricinus communis] gi|223545758|gb|EEF47262.1| DELLA protein RGL2, putative [Ricinus communis] Length = 642 Score = 60.1 bits (144), Expect = 6e-07 Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 10/58 (17%) Frame = +3 Query: 12 YTRKCQIQIQLSESAKYQASLVLEQF----------DGKALIVGWKGTPIQSLTAWKF 155 ++R ++I SESA YQASLV +QF +GK LIVGWKGTP+ SL+AWKF Sbjct: 571 FSRFRMVEIGFSESALYQASLVCKQFACGSSCSLDKNGKCLIVGWKGTPLHSLSAWKF 628 >ref|XP_010322387.1| PREDICTED: DELLA protein RGL1-like [Solanum lycopersicum] Length = 584 Score = 59.7 bits (143), Expect = 8e-07 Identities = 30/58 (51%), Positives = 38/58 (65%), Gaps = 10/58 (17%) Frame = +3 Query: 12 YTRKCQIQIQLSESAKYQASLVLEQF----------DGKALIVGWKGTPIQSLTAWKF 155 + R ++ +LSESA YQA L+L+QF DGK LI+GWKGTPI SL+ WKF Sbjct: 526 FARFGMVEEELSESAWYQAHLILKQFAQGSSCDLQKDGKGLIIGWKGTPIHSLSIWKF 583 >ref|XP_009616214.1| PREDICTED: DELLA protein RGL1-like [Nicotiana tomentosiformis] Length = 584 Score = 58.5 bits (140), Expect = 2e-06 Identities = 28/58 (48%), Positives = 41/58 (70%), Gaps = 10/58 (17%) Frame = +3 Query: 12 YTRKCQIQIQLSESAKYQASLVLEQF----------DGKALIVGWKGTPIQSLTAWKF 155 + R ++++LSES+ YQA+L+L+QF DGKAL+VGWKGT I+S++ WKF Sbjct: 526 FARFGMVEMELSESSWYQANLILKQFSQGSSCNVQNDGKALLVGWKGTAIESVSIWKF 583 >ref|XP_009628660.1| PREDICTED: DELLA protein RGL1-like [Nicotiana tomentosiformis] Length = 593 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 10/58 (17%) Frame = +3 Query: 12 YTRKCQIQIQLSESAKYQASLVLEQF----------DGKALIVGWKGTPIQSLTAWKF 155 + R ++ +LSESA YQA+L++++F DGK LI+GWKGTPI SL+ WKF Sbjct: 535 FARLGMVEEELSESAWYQANLIVKKFAQGSCCNLHKDGKGLIIGWKGTPIHSLSIWKF 592 >ref|XP_009378753.1| PREDICTED: DELLA protein RGL1-like [Pyrus x bretschneideri] Length = 627 Score = 58.2 bits (139), Expect = 2e-06 Identities = 30/58 (51%), Positives = 38/58 (65%), Gaps = 9/58 (15%) Frame = +3 Query: 12 YTRKCQIQIQLSESAKYQASLVLEQFD---------GKALIVGWKGTPIQSLTAWKFS 158 + R ++I LS +A YQASLV ++F GK LIVGWKGTPI SL+AWKF+ Sbjct: 570 FARFRMVEINLSNAALYQASLVAKKFGSPPCTLDWKGKCLIVGWKGTPIHSLSAWKFT 627 >ref|XP_010087232.1| hypothetical protein L484_009741 [Morus notabilis] gi|587837842|gb|EXB28582.1| hypothetical protein L484_009741 [Morus notabilis] Length = 607 Score = 57.4 bits (137), Expect = 4e-06 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 10/58 (17%) Frame = +3 Query: 12 YTRKCQIQIQLSESAKYQASLVLEQF----------DGKALIVGWKGTPIQSLTAWKF 155 +TR ++I+LS+S+ YQASLV +QF +GK L+VGWKGT I S +AWKF Sbjct: 549 FTRFGMVEIKLSDSSHYQASLVAKQFGCGNSCTLERNGKCLMVGWKGTAIHSFSAWKF 606 >ref|XP_012846595.1| PREDICTED: DELLA protein RGL3-like [Erythranthe guttatus] Length = 549 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 10/50 (20%) Frame = +3 Query: 33 QIQLSESAKYQASLVLEQF----------DGKALIVGWKGTPIQSLTAWK 152 +I+LS+S+ YQA+LVL+ F DGK+LI+GWKGTPI SL+AWK Sbjct: 495 EIELSDSSIYQANLVLKNFAFGDSFTFNFDGKSLIIGWKGTPISSLSAWK 544