BLASTX nr result
ID: Perilla23_contig00025235
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00025235 (364 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011102171.1| PREDICTED: pentatricopeptide repeat-containi... 59 1e-06 >ref|XP_011102171.1| PREDICTED: pentatricopeptide repeat-containing protein At3g02650, mitochondrial [Sesamum indicum] Length = 609 Score = 59.3 bits (142), Expect = 1e-06 Identities = 33/56 (58%), Positives = 37/56 (66%), Gaps = 5/56 (8%) Frame = -1 Query: 154 RFFSSNSAESHEDLASVPPISEDNETTGGFDFSGLNESGG-----FEDEDSIFDGV 2 RFFSSN A +ED AS PPISE E TG FDFS +N G FE+EDSIF+ V Sbjct: 58 RFFSSNPAGKYEDPASEPPISEATEITGDFDFSSVNVVDGTTKPEFENEDSIFNDV 113