BLASTX nr result
ID: Perilla23_contig00023396
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00023396 (421 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011072922.1| PREDICTED: lysine-specific demethylase REF6 ... 63 8e-08 ref|XP_012834201.1| PREDICTED: lysine-specific demethylase REF6 ... 60 8e-07 >ref|XP_011072922.1| PREDICTED: lysine-specific demethylase REF6 isoform X1 [Sesamum indicum] Length = 1316 Score = 63.2 bits (152), Expect = 8e-08 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = -1 Query: 97 MAAEASGAGNIEVSPWLKSMAVAPEYHPTLAE 2 MAAE SG GNIEVSPWLKSM VAPEYHPTLAE Sbjct: 1 MAAEVSGGGNIEVSPWLKSMPVAPEYHPTLAE 32 >ref|XP_012834201.1| PREDICTED: lysine-specific demethylase REF6 [Erythranthe guttatus] Length = 1222 Score = 59.7 bits (143), Expect = 8e-07 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -1 Query: 97 MAAEASGAGNIEVSPWLKSMAVAPEYHPTLAE 2 MAAE G G+IEVSPWLKSM VAPEYHPTLAE Sbjct: 1 MAAEVGGGGSIEVSPWLKSMPVAPEYHPTLAE 32