BLASTX nr result
ID: Perilla23_contig00019941
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00019941 (573 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011069934.1| PREDICTED: pentatricopeptide repeat-containi... 154 2e-35 emb|CDP02999.1| unnamed protein product [Coffea canephora] 143 7e-32 ref|XP_009797419.1| PREDICTED: pentatricopeptide repeat-containi... 142 1e-31 ref|XP_009620134.1| PREDICTED: pentatricopeptide repeat-containi... 142 1e-31 ref|XP_012837595.1| PREDICTED: pentatricopeptide repeat-containi... 141 2e-31 gb|EYU37311.1| hypothetical protein MIMGU_mgv1a009465mg [Erythra... 141 2e-31 ref|XP_006344540.1| PREDICTED: pentatricopeptide repeat-containi... 141 3e-31 gb|AHZ34329.1| pentatricopeptide repeat protein [Gossypium hirsu... 140 3e-31 ref|XP_002267263.1| PREDICTED: pentatricopeptide repeat-containi... 140 4e-31 emb|CAN75494.1| hypothetical protein VITISV_030525 [Vitis vinifera] 140 4e-31 ref|XP_010105599.1| hypothetical protein L484_003973 [Morus nota... 140 6e-31 ref|XP_004242906.1| PREDICTED: pentatricopeptide repeat-containi... 140 6e-31 ref|XP_012442328.1| PREDICTED: pentatricopeptide repeat-containi... 139 1e-30 ref|XP_007014231.1| Tetratricopeptide repeat (TPR)-like superfam... 139 1e-30 gb|EPS73575.1| hypothetical protein M569_01175 [Genlisea aurea] 136 6e-30 ref|XP_009349886.1| PREDICTED: pentatricopeptide repeat-containi... 134 2e-29 ref|XP_009342887.1| PREDICTED: pentatricopeptide repeat-containi... 134 2e-29 ref|XP_004296451.1| PREDICTED: pentatricopeptide repeat-containi... 133 5e-29 ref|XP_008391640.1| PREDICTED: pentatricopeptide repeat-containi... 133 7e-29 ref|XP_008228160.1| PREDICTED: pentatricopeptide repeat-containi... 132 9e-29 >ref|XP_011069934.1| PREDICTED: pentatricopeptide repeat-containing protein At2g18940, chloroplastic [Sesamum indicum] Length = 838 Score = 154 bits (390), Expect = 2e-35 Identities = 69/94 (73%), Positives = 84/94 (89%) Frame = -1 Query: 573 YSEMTTRGIRPCIVTYNTFIAGFSARGLFIEVGEVITYMIRNNCRPNELTYNIIIDGYCK 394 ++EMT RGIRPCIVTYNTFIAGFS RG F EV EVI+YMI++NCRPNELTYN ++DGYCK Sbjct: 740 FTEMTNRGIRPCIVTYNTFIAGFSGRGFFQEVDEVISYMIQHNCRPNELTYNTVVDGYCK 799 Query: 393 ARRYKDAMDFIANIRENDTTYSDQALRRLVIRLK 292 A+RYKDAMDF++ I+E D TYS+QAL+RLV R++ Sbjct: 800 AKRYKDAMDFVSTIKEKDITYSEQALQRLVYRVR 833 >emb|CDP02999.1| unnamed protein product [Coffea canephora] Length = 852 Score = 143 bits (360), Expect = 7e-32 Identities = 61/94 (64%), Positives = 82/94 (87%) Frame = -1 Query: 573 YSEMTTRGIRPCIVTYNTFIAGFSARGLFIEVGEVITYMIRNNCRPNELTYNIIIDGYCK 394 +SEMT+RGIRPCIVTYNTF+AGF+ RGLF +V E+I YMI++NCRPNELTY I+DGYCK Sbjct: 754 FSEMTSRGIRPCIVTYNTFVAGFAGRGLFSQVDELIDYMIQHNCRPNELTYKTIVDGYCK 813 Query: 393 ARRYKDAMDFIANIRENDTTYSDQALRRLVIRLK 292 A++YK+AMDF++NI+E D + +Q+L RL +R++ Sbjct: 814 AKKYKEAMDFVSNIKERDASCDEQSLHRLALRVR 847 >ref|XP_009797419.1| PREDICTED: pentatricopeptide repeat-containing protein At2g18940, chloroplastic [Nicotiana sylvestris] Length = 845 Score = 142 bits (358), Expect = 1e-31 Identities = 60/94 (63%), Positives = 82/94 (87%) Frame = -1 Query: 573 YSEMTTRGIRPCIVTYNTFIAGFSARGLFIEVGEVITYMIRNNCRPNELTYNIIIDGYCK 394 +S+MT +GIRPCIVTYNTF+AGF+ARG+F EV E+I+YMI++ CRPNELTY I+DGYCK Sbjct: 747 FSQMTDKGIRPCIVTYNTFVAGFAARGMFSEVSELISYMIQHECRPNELTYKTIVDGYCK 806 Query: 393 ARRYKDAMDFIANIRENDTTYSDQALRRLVIRLK 292 A+RY++AMDF+ NIRE DTT+ +++L+R R++ Sbjct: 807 AKRYQEAMDFVLNIREKDTTFDEESLQRFASRVR 840 >ref|XP_009620134.1| PREDICTED: pentatricopeptide repeat-containing protein At2g18940, chloroplastic [Nicotiana tomentosiformis] Length = 846 Score = 142 bits (358), Expect = 1e-31 Identities = 60/94 (63%), Positives = 82/94 (87%) Frame = -1 Query: 573 YSEMTTRGIRPCIVTYNTFIAGFSARGLFIEVGEVITYMIRNNCRPNELTYNIIIDGYCK 394 +S+MT +GIRPCIVTYNTF+AGF+ARG+F EV E+I+YMI++ CRPNELTY I+DGYCK Sbjct: 748 FSQMTEKGIRPCIVTYNTFVAGFAARGMFSEVNELISYMIQHECRPNELTYKTIVDGYCK 807 Query: 393 ARRYKDAMDFIANIRENDTTYSDQALRRLVIRLK 292 A+RY++AMDF+ NIRE DTT+ +++L+R R++ Sbjct: 808 AKRYQEAMDFVLNIREKDTTFDEESLQRFASRVR 841 >ref|XP_012837595.1| PREDICTED: pentatricopeptide repeat-containing protein At2g18940, chloroplastic [Erythranthe guttatus] Length = 833 Score = 141 bits (356), Expect = 2e-31 Identities = 62/93 (66%), Positives = 80/93 (86%) Frame = -1 Query: 570 SEMTTRGIRPCIVTYNTFIAGFSARGLFIEVGEVITYMIRNNCRPNELTYNIIIDGYCKA 391 +EMT+RGIRPCIVTYNTF+AGFSARG F EV EVI+YMI +NCRPNELTY I+DGYCKA Sbjct: 736 TEMTSRGIRPCIVTYNTFVAGFSARGFFQEVDEVISYMIEDNCRPNELTYTTIVDGYCKA 795 Query: 390 RRYKDAMDFIANIRENDTTYSDQALRRLVIRLK 292 ++YKDAM+F++ I+E D Y +++ +RLV R++ Sbjct: 796 KKYKDAMEFVSRIKEKDGLYGEESTQRLVSRIR 828 >gb|EYU37311.1| hypothetical protein MIMGU_mgv1a009465mg [Erythranthe guttata] Length = 341 Score = 141 bits (356), Expect = 2e-31 Identities = 62/93 (66%), Positives = 80/93 (86%) Frame = -1 Query: 570 SEMTTRGIRPCIVTYNTFIAGFSARGLFIEVGEVITYMIRNNCRPNELTYNIIIDGYCKA 391 +EMT+RGIRPCIVTYNTF+AGFSARG F EV EVI+YMI +NCRPNELTY I+DGYCKA Sbjct: 244 TEMTSRGIRPCIVTYNTFVAGFSARGFFQEVDEVISYMIEDNCRPNELTYTTIVDGYCKA 303 Query: 390 RRYKDAMDFIANIRENDTTYSDQALRRLVIRLK 292 ++YKDAM+F++ I+E D Y +++ +RLV R++ Sbjct: 304 KKYKDAMEFVSRIKEKDGLYGEESTQRLVSRIR 336 >ref|XP_006344540.1| PREDICTED: pentatricopeptide repeat-containing protein At2g18940, chloroplastic-like [Solanum tuberosum] Length = 842 Score = 141 bits (355), Expect = 3e-31 Identities = 60/94 (63%), Positives = 81/94 (86%) Frame = -1 Query: 573 YSEMTTRGIRPCIVTYNTFIAGFSARGLFIEVGEVITYMIRNNCRPNELTYNIIIDGYCK 394 +S+MT +GIRPCIVTYNTFIAGF+ARG+F EV E+I+YMI++ CRPNELTY I+DGYCK Sbjct: 744 FSQMTEKGIRPCIVTYNTFIAGFAARGMFSEVNELISYMIQHECRPNELTYKTIVDGYCK 803 Query: 393 ARRYKDAMDFIANIRENDTTYSDQALRRLVIRLK 292 A+RY+DAMDF+ NI+E D T+ +++L+R R++ Sbjct: 804 AKRYQDAMDFVLNIKEKDNTFDEESLQRFASRVR 837 >gb|AHZ34329.1| pentatricopeptide repeat protein [Gossypium hirsutum] Length = 851 Score = 140 bits (354), Expect = 3e-31 Identities = 58/93 (62%), Positives = 82/93 (88%) Frame = -1 Query: 570 SEMTTRGIRPCIVTYNTFIAGFSARGLFIEVGEVITYMIRNNCRPNELTYNIIIDGYCKA 391 SEMTT+GIRPCI TYNTF+AG++A+G+F E+ +VI++MI++NC+PNELTY I++DGYCKA Sbjct: 754 SEMTTKGIRPCIFTYNTFVAGYAAQGMFTEIDDVISHMIQHNCKPNELTYKIVVDGYCKA 813 Query: 390 RRYKDAMDFIANIRENDTTYSDQALRRLVIRLK 292 RRYKDAMDF++ I+E D ++ DQ++ RL R++ Sbjct: 814 RRYKDAMDFVSKIKEIDDSFEDQSIERLAFRVR 846 >ref|XP_002267263.1| PREDICTED: pentatricopeptide repeat-containing protein At2g18940, chloroplastic [Vitis vinifera] gi|297735424|emb|CBI17864.3| unnamed protein product [Vitis vinifera] Length = 821 Score = 140 bits (353), Expect = 4e-31 Identities = 60/93 (64%), Positives = 80/93 (86%) Frame = -1 Query: 570 SEMTTRGIRPCIVTYNTFIAGFSARGLFIEVGEVITYMIRNNCRPNELTYNIIIDGYCKA 391 SEMT GIRPCIVTYNTF+AG+S +G+F EV EVI+YMI+++CRPNELTY I++DGYCK Sbjct: 724 SEMTISGIRPCIVTYNTFVAGYSGKGMFSEVEEVISYMIQHDCRPNELTYKIVVDGYCKG 783 Query: 390 RRYKDAMDFIANIRENDTTYSDQALRRLVIRLK 292 ++YK+AMDF++NI E D ++ DQ+LRRL R++ Sbjct: 784 KKYKEAMDFVSNITEMDKSFDDQSLRRLTFRIR 816 >emb|CAN75494.1| hypothetical protein VITISV_030525 [Vitis vinifera] Length = 821 Score = 140 bits (353), Expect = 4e-31 Identities = 60/93 (64%), Positives = 80/93 (86%) Frame = -1 Query: 570 SEMTTRGIRPCIVTYNTFIAGFSARGLFIEVGEVITYMIRNNCRPNELTYNIIIDGYCKA 391 SEMT GIRPCIVTYNTF+AG+S +G+F EV EVI+YMI+++CRPNELTY I++DGYCK Sbjct: 724 SEMTISGIRPCIVTYNTFVAGYSGKGMFSEVEEVISYMIQHDCRPNELTYKIVVDGYCKG 783 Query: 390 RRYKDAMDFIANIRENDTTYSDQALRRLVIRLK 292 ++YK+AMDF++NI E D ++ DQ+LRRL R++ Sbjct: 784 KKYKEAMDFVSNITEMDKSFDDQSLRRLTFRIR 816 >ref|XP_010105599.1| hypothetical protein L484_003973 [Morus notabilis] gi|587917606|gb|EXC05166.1| hypothetical protein L484_003973 [Morus notabilis] Length = 807 Score = 140 bits (352), Expect = 6e-31 Identities = 61/95 (64%), Positives = 77/95 (81%) Frame = -1 Query: 570 SEMTTRGIRPCIVTYNTFIAGFSARGLFIEVGEVITYMIRNNCRPNELTYNIIIDGYCKA 391 SEMTT GIRPCI TYNTF+ G+ RG+F EV EVI YMI NNCRPNELTY I++DGYCKA Sbjct: 710 SEMTTSGIRPCIFTYNTFVTGYVGRGMFSEVDEVIRYMIENNCRPNELTYKIVVDGYCKA 769 Query: 390 RRYKDAMDFIANIRENDTTYSDQALRRLVIRLKRK 286 RYK+AMDF++NI+E D ++ D +++RL R++ K Sbjct: 770 GRYKEAMDFVSNIKEVDNSFDDHSVQRLASRIREK 804 >ref|XP_004242906.1| PREDICTED: pentatricopeptide repeat-containing protein At2g18940, chloroplastic [Solanum lycopersicum] Length = 842 Score = 140 bits (352), Expect = 6e-31 Identities = 59/94 (62%), Positives = 81/94 (86%) Frame = -1 Query: 573 YSEMTTRGIRPCIVTYNTFIAGFSARGLFIEVGEVITYMIRNNCRPNELTYNIIIDGYCK 394 +S+MT +GIRPCIVTYNTF+AGF+ARG+F EV E+I+YMI++ CRPNELTY I+DGYCK Sbjct: 744 FSQMTEKGIRPCIVTYNTFMAGFAARGMFSEVNELISYMIQHKCRPNELTYKTIVDGYCK 803 Query: 393 ARRYKDAMDFIANIRENDTTYSDQALRRLVIRLK 292 A+RY+DAMDF+ NI+E D T+ +++L+R R++ Sbjct: 804 AKRYQDAMDFVLNIKEKDNTFDEESLQRFASRVR 837 >ref|XP_012442328.1| PREDICTED: pentatricopeptide repeat-containing protein At2g18940, chloroplastic [Gossypium raimondii] gi|763786776|gb|KJB53772.1| hypothetical protein B456_009G004300 [Gossypium raimondii] Length = 851 Score = 139 bits (350), Expect = 1e-30 Identities = 57/93 (61%), Positives = 82/93 (88%) Frame = -1 Query: 570 SEMTTRGIRPCIVTYNTFIAGFSARGLFIEVGEVITYMIRNNCRPNELTYNIIIDGYCKA 391 SEMTT+GIRPCI TYNTF+AG++A+G+F E+ +VI++MI++NC+PNELTY I++DGYCKA Sbjct: 754 SEMTTKGIRPCIFTYNTFVAGYAAQGMFTEIDDVISHMIQHNCKPNELTYKIVVDGYCKA 813 Query: 390 RRYKDAMDFIANIRENDTTYSDQALRRLVIRLK 292 RRYKDA+DF++ I+E D ++ DQ++ RL R++ Sbjct: 814 RRYKDAIDFVSKIKEIDDSFDDQSIERLAFRVR 846 >ref|XP_007014231.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] gi|508784594|gb|EOY31850.1| Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 845 Score = 139 bits (349), Expect = 1e-30 Identities = 57/94 (60%), Positives = 82/94 (87%) Frame = -1 Query: 573 YSEMTTRGIRPCIVTYNTFIAGFSARGLFIEVGEVITYMIRNNCRPNELTYNIIIDGYCK 394 +SEMTTRGIRPCI TYNTF+AG++++G+F E+ +VI YMI++NC+PNELTY I++DGYCK Sbjct: 747 FSEMTTRGIRPCIFTYNTFVAGYASQGMFTEIDDVIGYMIQHNCKPNELTYKIVVDGYCK 806 Query: 393 ARRYKDAMDFIANIRENDTTYSDQALRRLVIRLK 292 ARRYK+AMDF++ I+E D ++ +Q++ RL R++ Sbjct: 807 ARRYKEAMDFVSKIKEIDDSFDEQSIDRLAFRVR 840 >gb|EPS73575.1| hypothetical protein M569_01175 [Genlisea aurea] Length = 760 Score = 136 bits (343), Expect = 6e-30 Identities = 61/92 (66%), Positives = 73/92 (79%) Frame = -1 Query: 567 EMTTRGIRPCIVTYNTFIAGFSARGLFIEVGEVITYMIRNNCRPNELTYNIIIDGYCKAR 388 EMT RGIRPCIVTYNT + GFS RG+F EV E+I YM+ N CRPNELTYN ++DGYCKAR Sbjct: 663 EMTERGIRPCIVTYNTLVGGFSGRGMFNEVDELIDYMVENGCRPNELTYNKVVDGYCKAR 722 Query: 387 RYKDAMDFIANIRENDTTYSDQALRRLVIRLK 292 R KDAMDF+ IRE D Y ++ L+RLV R++ Sbjct: 723 RSKDAMDFVGRIRERDGGYGEEGLQRLVYRVR 754 >ref|XP_009349886.1| PREDICTED: pentatricopeptide repeat-containing protein At2g18940, chloroplastic-like [Pyrus x bretschneideri] Length = 834 Score = 134 bits (338), Expect = 2e-29 Identities = 58/93 (62%), Positives = 78/93 (83%) Frame = -1 Query: 570 SEMTTRGIRPCIVTYNTFIAGFSARGLFIEVGEVITYMIRNNCRPNELTYNIIIDGYCKA 391 SEMTTRGIRPCI TYNTFI G++ +G+ E+ EVI+YM +NNCRPNEL+Y I +DGYCKA Sbjct: 737 SEMTTRGIRPCIFTYNTFITGYAGQGMLSEMDEVISYMTQNNCRPNELSYKIAVDGYCKA 796 Query: 390 RRYKDAMDFIANIRENDTTYSDQALRRLVIRLK 292 R+YK+AMDF++ I+E DT++ DQ ++RL R++ Sbjct: 797 RKYKEAMDFLSKIKEIDTSFDDQYVQRLASRIR 829 >ref|XP_009342887.1| PREDICTED: pentatricopeptide repeat-containing protein At2g18940, chloroplastic-like [Pyrus x bretschneideri] Length = 841 Score = 134 bits (338), Expect = 2e-29 Identities = 58/93 (62%), Positives = 78/93 (83%) Frame = -1 Query: 570 SEMTTRGIRPCIVTYNTFIAGFSARGLFIEVGEVITYMIRNNCRPNELTYNIIIDGYCKA 391 SEMTTRGIRPCI TYNTFI G++ +G+ E+ EVI+YM +NNCRPNEL+Y I +DGYCKA Sbjct: 744 SEMTTRGIRPCIFTYNTFITGYAGQGMLSEMDEVISYMTQNNCRPNELSYKIAVDGYCKA 803 Query: 390 RRYKDAMDFIANIRENDTTYSDQALRRLVIRLK 292 R+YK+AMDF++ I+E DT++ DQ ++RL R++ Sbjct: 804 RKYKEAMDFLSKIKEIDTSFDDQYVQRLASRIR 836 >ref|XP_004296451.1| PREDICTED: pentatricopeptide repeat-containing protein At2g18940, chloroplastic [Fragaria vesca subsp. vesca] Length = 846 Score = 133 bits (335), Expect = 5e-29 Identities = 57/93 (61%), Positives = 77/93 (82%) Frame = -1 Query: 570 SEMTTRGIRPCIVTYNTFIAGFSARGLFIEVGEVITYMIRNNCRPNELTYNIIIDGYCKA 391 SEMTTRGIRPCI TYNTF+ G+S RG+F EV EVI+YM +NNC+PNELTY I++DGYCKA Sbjct: 740 SEMTTRGIRPCIFTYNTFVTGYSGRGMFSEVDEVISYMTQNNCKPNELTYKIVVDGYCKA 799 Query: 390 RRYKDAMDFIANIRENDTTYSDQALRRLVIRLK 292 R++++AMDF++ I+E D ++ D + RL R++ Sbjct: 800 RKFEEAMDFLSKIKEIDNSFDDGYVERLSSRIR 832 >ref|XP_008391640.1| PREDICTED: pentatricopeptide repeat-containing protein At2g18940, chloroplastic [Malus domestica] Length = 841 Score = 133 bits (334), Expect = 7e-29 Identities = 57/93 (61%), Positives = 78/93 (83%) Frame = -1 Query: 570 SEMTTRGIRPCIVTYNTFIAGFSARGLFIEVGEVITYMIRNNCRPNELTYNIIIDGYCKA 391 SEMTTRGIRPCI TYNTFI G++ +G+F E+ EVI+YM +NNCRPNEL+Y I +DGYCKA Sbjct: 744 SEMTTRGIRPCIFTYNTFITGYAGQGMFSEIDEVISYMTQNNCRPNELSYKIAVDGYCKA 803 Query: 390 RRYKDAMDFIANIRENDTTYSDQALRRLVIRLK 292 R+YK+A+DF++ I+E D++ DQ ++RL R++ Sbjct: 804 RKYKEAIDFLSTIKEIDSSIDDQYVQRLASRIR 836 >ref|XP_008228160.1| PREDICTED: pentatricopeptide repeat-containing protein At2g18940, chloroplastic [Prunus mume] Length = 842 Score = 132 bits (333), Expect = 9e-29 Identities = 56/93 (60%), Positives = 77/93 (82%) Frame = -1 Query: 570 SEMTTRGIRPCIVTYNTFIAGFSARGLFIEVGEVITYMIRNNCRPNELTYNIIIDGYCKA 391 SEMT RGIRPCI TYNTFI G++ +G+F E+ EVI+YM +NNC+PNEL+Y I +DGYCKA Sbjct: 745 SEMTARGIRPCIFTYNTFITGYAGQGMFSEIDEVISYMTQNNCKPNELSYKIAVDGYCKA 804 Query: 390 RRYKDAMDFIANIRENDTTYSDQALRRLVIRLK 292 R+YK+AMDF++ I+E D ++ DQ ++RL R++ Sbjct: 805 RKYKEAMDFLSKIKEIDNSFDDQYVQRLASRIR 837