BLASTX nr result
ID: Perilla23_contig00019936
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00019936 (561 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011098248.1| PREDICTED: transcription factor GTE4-like is... 57 8e-06 ref|XP_011098247.1| PREDICTED: transcription factor GTE4-like is... 57 8e-06 ref|XP_011098246.1| PREDICTED: transcription factor GTE4-like is... 57 8e-06 >ref|XP_011098248.1| PREDICTED: transcription factor GTE4-like isoform X3 [Sesamum indicum] Length = 863 Score = 56.6 bits (135), Expect = 8e-06 Identities = 25/42 (59%), Positives = 30/42 (71%) Frame = -2 Query: 131 MESGSVGDSGDDLNWRRSHRWTGNCIVYTRRIQKKTHKTNND 6 M SG++GDS DDLNWR RWT N VYTRR KK K++N+ Sbjct: 1 MASGTLGDSSDDLNWRGRCRWTENSKVYTRRFHKKAQKSSNN 42 >ref|XP_011098247.1| PREDICTED: transcription factor GTE4-like isoform X2 [Sesamum indicum] Length = 876 Score = 56.6 bits (135), Expect = 8e-06 Identities = 25/42 (59%), Positives = 30/42 (71%) Frame = -2 Query: 131 MESGSVGDSGDDLNWRRSHRWTGNCIVYTRRIQKKTHKTNND 6 M SG++GDS DDLNWR RWT N VYTRR KK K++N+ Sbjct: 1 MASGTLGDSSDDLNWRGRCRWTENSKVYTRRFHKKAQKSSNN 42 >ref|XP_011098246.1| PREDICTED: transcription factor GTE4-like isoform X1 [Sesamum indicum] Length = 881 Score = 56.6 bits (135), Expect = 8e-06 Identities = 25/42 (59%), Positives = 30/42 (71%) Frame = -2 Query: 131 MESGSVGDSGDDLNWRRSHRWTGNCIVYTRRIQKKTHKTNND 6 M SG++GDS DDLNWR RWT N VYTRR KK K++N+ Sbjct: 1 MASGTLGDSSDDLNWRGRCRWTENSKVYTRRFHKKAQKSSNN 42