BLASTX nr result
ID: Perilla23_contig00019567
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00019567 (479 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KQJ93626.1| hypothetical protein BRADI_3g05811 [Brachypodium ... 58 3e-06 >gb|KQJ93626.1| hypothetical protein BRADI_3g05811 [Brachypodium distachyon] Length = 102 Score = 57.8 bits (138), Expect = 3e-06 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = +2 Query: 2 FQ*EQARIKRAKAMRPSIAANPPKRYGTGECHGERCTADGGA 127 FQ EQAR + A RPSIAA+ PKRYGTG+CHGER AD GA Sbjct: 40 FQWEQARARSESATRPSIAASAPKRYGTGDCHGER--ADDGA 79