BLASTX nr result
ID: Perilla23_contig00018472
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00018472 (318 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU23280.1| hypothetical protein MIMGU_mgv1a000166mg [Erythra... 57 5e-06 >gb|EYU23280.1| hypothetical protein MIMGU_mgv1a000166mg [Erythranthe guttata] Length = 1512 Score = 57.0 bits (136), Expect = 5e-06 Identities = 36/81 (44%), Positives = 46/81 (56%), Gaps = 1/81 (1%) Frame = -3 Query: 241 TPFRLVFLLWMCVGIKVSYCIDTQRQG-ESLNSSSQLDSPNGLFTLRFYTPGVTNNSYMV 65 TPF VFL+ + IDT + G + NSSSQL S +FTL FYTP TNNSY+ Sbjct: 9 TPF--VFLISLHFLATQVSSIDTLKPGGDEFNSSSQLVSAKKIFTLGFYTPENTNNSYLA 66 Query: 64 VLFNGGANAPVQIPTVWVGNR 2 + + G +P VW+GNR Sbjct: 67 IWYTDGLYSP-----VWIGNR 82