BLASTX nr result
ID: Perilla23_contig00018418
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00018418 (370 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009764368.1| PREDICTED: cysteine-rich and transmembrane d... 65 3e-08 ref|XP_009600875.1| PREDICTED: cysteine-rich and transmembrane d... 61 3e-07 ref|XP_009349066.1| PREDICTED: cysteine-rich and transmembrane d... 58 2e-06 >ref|XP_009764368.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Nicotiana sylvestris] Length = 62 Score = 64.7 bits (156), Expect = 3e-08 Identities = 34/61 (55%), Positives = 41/61 (67%), Gaps = 2/61 (3%) Frame = -2 Query: 324 KMQNQASQPPPGYPSENHPPTGKK--KMKWRPRTKAKGDRGFIEXXXXXXXXXXXCEVCF 151 K +NQ +QPPPGYP+E+ PTGKK KMK PR+K KG+RGF+E CEVCF Sbjct: 3 KQENQVNQPPPGYPTES-TPTGKKNKKMKCFPRSKPKGERGFLEGCLFALCCCWICEVCF 61 Query: 150 D 148 D Sbjct: 62 D 62 >ref|XP_009600875.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Nicotiana tomentosiformis] Length = 61 Score = 61.2 bits (147), Expect = 3e-07 Identities = 32/60 (53%), Positives = 40/60 (66%), Gaps = 2/60 (3%) Frame = -2 Query: 324 KMQNQASQPPPGYPSENHPPTGK--KKMKWRPRTKAKGDRGFIEXXXXXXXXXXXCEVCF 151 K +NQ +QPPPGYP+E+ PTGK KKMK P++K KG+RGF+E CEVCF Sbjct: 3 KQENQVNQPPPGYPTES-TPTGKKNKKMKCFPKSKPKGERGFLEGCLFALCCCWICEVCF 61 >ref|XP_009349066.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Pyrus x bretschneideri] Length = 61 Score = 58.2 bits (139), Expect = 2e-06 Identities = 32/60 (53%), Positives = 38/60 (63%), Gaps = 2/60 (3%) Frame = -2 Query: 324 KMQNQASQPPPGYPS--ENHPPTGKKKMKWRPRTKAKGDRGFIEXXXXXXXXXXXCEVCF 151 K + Q +QPPPGYP+ EN PP+ K K+RPRTKAKG+RGFIE CE CF Sbjct: 3 KTETQENQPPPGYPTATENPPPSPTGK-KFRPRTKAKGERGFIEGCLFALCCCWLCEECF 61