BLASTX nr result
ID: Perilla23_contig00018390
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00018390 (433 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012855859.1| PREDICTED: uncharacterized protein LOC105975... 65 3e-08 gb|EYU21912.1| hypothetical protein MIMGU_mgv1a000755mg [Erythra... 65 3e-08 ref|XP_011081881.1| PREDICTED: uncharacterized protein LOC105164... 64 4e-08 ref|XP_011087545.1| PREDICTED: uncharacterized protein LOC105168... 60 8e-07 >ref|XP_012855859.1| PREDICTED: uncharacterized protein LOC105975229 [Erythranthe guttatus] Length = 1029 Score = 64.7 bits (156), Expect = 3e-08 Identities = 32/48 (66%), Positives = 39/48 (81%), Gaps = 1/48 (2%) Frame = -1 Query: 433 DDLPEFNFSGDLNLSSSRITSNDSLH-ALKKTKRPVDQVRELIKKYGQ 293 DDLPEFNFSG++N ++ I S +LH +K T+RPVDQVRELIKKYGQ Sbjct: 886 DDLPEFNFSGNMNTAAMPIISPHNLHQGVKMTQRPVDQVRELIKKYGQ 933 >gb|EYU21912.1| hypothetical protein MIMGU_mgv1a000755mg [Erythranthe guttata] Length = 993 Score = 64.7 bits (156), Expect = 3e-08 Identities = 32/48 (66%), Positives = 39/48 (81%), Gaps = 1/48 (2%) Frame = -1 Query: 433 DDLPEFNFSGDLNLSSSRITSNDSLH-ALKKTKRPVDQVRELIKKYGQ 293 DDLPEFNFSG++N ++ I S +LH +K T+RPVDQVRELIKKYGQ Sbjct: 850 DDLPEFNFSGNMNTAAMPIISPHNLHQGVKMTQRPVDQVRELIKKYGQ 897 >ref|XP_011081881.1| PREDICTED: uncharacterized protein LOC105164803 [Sesamum indicum] Length = 1045 Score = 63.9 bits (154), Expect = 4e-08 Identities = 31/47 (65%), Positives = 36/47 (76%) Frame = -1 Query: 433 DDLPEFNFSGDLNLSSSRITSNDSLHALKKTKRPVDQVRELIKKYGQ 293 DDLPEF+FSG++N S RI+ + H K T RPVDQVRELIKKYGQ Sbjct: 898 DDLPEFSFSGNINPSVPRISPQNLHHGAKLTHRPVDQVRELIKKYGQ 944 >ref|XP_011087545.1| PREDICTED: uncharacterized protein LOC105168969 [Sesamum indicum] Length = 1017 Score = 59.7 bits (143), Expect = 8e-07 Identities = 32/47 (68%), Positives = 36/47 (76%) Frame = -1 Query: 433 DDLPEFNFSGDLNLSSSRITSNDSLHALKKTKRPVDQVRELIKKYGQ 293 DDLPEF FSG LN S RI S +L +K T+RPVDQVRELI+KYGQ Sbjct: 874 DDLPEFTFSGGLNPSVPRI-SPQNLSRVKMTQRPVDQVRELIQKYGQ 919