BLASTX nr result
ID: Perilla23_contig00018054
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00018054 (520 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011095359.1| PREDICTED: glucose-6-phosphate/phosphate tra... 67 7e-09 ref|XP_011097912.1| PREDICTED: glucose-6-phosphate/phosphate tra... 60 8e-07 gb|EPS72032.1| glucose-6-phosphate/phosphate translocator 1, chl... 57 5e-06 >ref|XP_011095359.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like [Sesamum indicum] Length = 391 Score = 66.6 bits (161), Expect = 7e-09 Identities = 41/90 (45%), Positives = 55/90 (61%), Gaps = 3/90 (3%) Frame = -3 Query: 263 MISSLKQPSTSLSTIHGXXXXXXXXXXXXXXXXXSPLLPA-RTRRVSIVSLSRPVHITKV 87 MISSLKQP+ L H P LPA +T R ++VSLS+P+H++KV Sbjct: 1 MISSLKQPALPL---HDSNFRHSRRNFLARHSPVLPSLPAVKTSRGAVVSLSKPLHVSKV 57 Query: 86 ESFE--RKDRSSLITCGAYEADRSEPVGET 3 ESF ++ + SLITC AYEADRS+P+ E+ Sbjct: 58 ESFSINKEKKPSLITCKAYEADRSKPIVES 87 >ref|XP_011097912.1| PREDICTED: glucose-6-phosphate/phosphate translocator 1, chloroplastic-like [Sesamum indicum] Length = 391 Score = 59.7 bits (143), Expect = 8e-07 Identities = 29/55 (52%), Positives = 39/55 (70%), Gaps = 3/55 (5%) Frame = -3 Query: 158 PLLPARTRRVSIVSLSRPVHITKVESFER---KDRSSLITCGAYEADRSEPVGET 3 P+ PA RR ++SLS+P+HI+KVESF + S I C AYEA+RSEP+GE+ Sbjct: 33 PVFPAEPRRTFVLSLSKPLHISKVESFSADAGTEGSRRIVCKAYEAERSEPIGES 87 >gb|EPS72032.1| glucose-6-phosphate/phosphate translocator 1, chloroplastic, partial [Genlisea aurea] Length = 313 Score = 57.0 bits (136), Expect = 5e-06 Identities = 29/49 (59%), Positives = 35/49 (71%) Frame = -3 Query: 158 PLLPARTRRVSIVSLSRPVHITKVESFERKDRSSLITCGAYEADRSEPV 12 P RR SIV+LSRP++I+K ESF DR+S I C AYEADRSEP+ Sbjct: 24 PFTLGEPRRTSIVNLSRPLYISKAESFSGGDRAS-IACNAYEADRSEPI 71