BLASTX nr result
ID: Perilla23_contig00016947
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00016947 (573 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011076229.1| PREDICTED: LOW QUALITY PROTEIN: BAG family m... 57 5e-06 >ref|XP_011076229.1| PREDICTED: LOW QUALITY PROTEIN: BAG family molecular chaperone regulator 2 [Sesamum indicum] Length = 349 Score = 57.4 bits (137), Expect = 5e-06 Identities = 29/51 (56%), Positives = 32/51 (62%), Gaps = 15/51 (29%) Frame = -2 Query: 110 MMRMRATNEWLPPQSNG---------------GGGGEKVWELRPGGMLVQK 3 MMRMR N++LPPQ+NG GGGEK WELRPGGMLVQK Sbjct: 1 MMRMRTKNDYLPPQTNGDDLGRSGDGGGGGGRSGGGEKEWELRPGGMLVQK 51