BLASTX nr result
ID: Perilla23_contig00016422
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00016422 (675 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011079631.1| PREDICTED: bifunctional epoxide hydrolase 2-... 51 3e-10 ref|XP_010038230.1| PREDICTED: bifunctional epoxide hydrolase 2-... 53 1e-09 ref|XP_010042740.1| PREDICTED: bifunctional epoxide hydrolase 2-... 53 1e-09 gb|KCW50054.1| hypothetical protein EUGRSUZ_K03494 [Eucalyptus g... 53 1e-09 ref|XP_006355815.1| PREDICTED: bifunctional epoxide hydrolase 2-... 47 2e-09 ref|XP_004240550.1| PREDICTED: bifunctional epoxide hydrolase 2-... 47 2e-09 ref|XP_012833716.1| PREDICTED: bifunctional epoxide hydrolase 2-... 48 6e-09 ref|XP_009620847.1| PREDICTED: bifunctional epoxide hydrolase 2-... 46 6e-09 ref|XP_014494768.1| PREDICTED: bifunctional epoxide hydrolase 2 ... 49 8e-09 emb|CDP17111.1| unnamed protein product [Coffea canephora] 50 1e-08 ref|XP_009771842.1| PREDICTED: bifunctional epoxide hydrolase 2-... 45 1e-08 gb|KOM39452.1| hypothetical protein LR48_Vigan03g283400 [Vigna a... 49 1e-08 ref|XP_003554527.1| PREDICTED: bifunctional epoxide hydrolase 2-... 48 1e-08 gb|KRG96458.1| hypothetical protein GLYMA_19G211900 [Glycine max] 48 1e-08 ref|XP_007222693.1| hypothetical protein PRUPE_ppa008676mg [Prun... 47 5e-08 ref|XP_007163124.1| hypothetical protein PHAVU_001G208300g [Phas... 47 5e-08 ref|XP_008355493.1| PREDICTED: bifunctional epoxide hydrolase 2-... 48 5e-08 ref|XP_007035641.1| Alpha/beta-Hydrolases superfamily protein [T... 46 6e-08 gb|KCW50060.1| hypothetical protein EUGRSUZ_K03501 [Eucalyptus g... 45 6e-08 ref|XP_010038235.1| PREDICTED: bifunctional epoxide hydrolase 2-... 45 6e-08 >ref|XP_011079631.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Sesamum indicum] Length = 317 Score = 50.8 bits (120), Expect(2) = 3e-10 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -1 Query: 504 MAWNFYLPRPDQIRALVNSSIMFQPRNPKRK 412 MAW F L RPD+I+ALVN S++FQPRNP+RK Sbjct: 106 MAWYFCLFRPDRIKALVNMSVVFQPRNPRRK 136 Score = 41.6 bits (96), Expect(2) = 3e-10 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = -3 Query: 415 KVMESMRAILGDDYYICRFQ 356 K +ESMRAILGDDYYICRFQ Sbjct: 136 KPVESMRAILGDDYYICRFQ 155 >ref|XP_010038230.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus grandis] gi|629083608|gb|KCW50053.1| hypothetical protein EUGRSUZ_K03494 [Eucalyptus grandis] Length = 319 Score = 52.8 bits (125), Expect(2) = 1e-09 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = -1 Query: 504 MAWNFYLPRPDQIRALVNSSIMFQPRNPKRK 412 MAW F L RPD+++ALVN+S++FQPRNPKRK Sbjct: 108 MAWYFCLLRPDRVKALVNTSVVFQPRNPKRK 138 Score = 37.4 bits (85), Expect(2) = 1e-09 Identities = 14/22 (63%), Positives = 19/22 (86%) Frame = -3 Query: 421 EEKVMESMRAILGDDYYICRFQ 356 + K ++S+RA+ GDDYYICRFQ Sbjct: 136 KRKPIDSLRALFGDDYYICRFQ 157 >ref|XP_010042740.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus grandis] Length = 238 Score = 52.8 bits (125), Expect(2) = 1e-09 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = -1 Query: 504 MAWNFYLPRPDQIRALVNSSIMFQPRNPKRK 412 MAW F L RPD+++ALVN+S++FQPRNPKRK Sbjct: 108 MAWYFCLLRPDRVKALVNTSVVFQPRNPKRK 138 Score = 37.4 bits (85), Expect(2) = 1e-09 Identities = 14/22 (63%), Positives = 19/22 (86%) Frame = -3 Query: 421 EEKVMESMRAILGDDYYICRFQ 356 + K ++S+RA+ GDDYYICRFQ Sbjct: 136 KRKPIDSLRALFGDDYYICRFQ 157 >gb|KCW50054.1| hypothetical protein EUGRSUZ_K03494 [Eucalyptus grandis] Length = 238 Score = 52.8 bits (125), Expect(2) = 1e-09 Identities = 22/31 (70%), Positives = 28/31 (90%) Frame = -1 Query: 504 MAWNFYLPRPDQIRALVNSSIMFQPRNPKRK 412 MAW F L RPD+++ALVN+S++FQPRNPKRK Sbjct: 108 MAWYFCLLRPDRVKALVNTSVVFQPRNPKRK 138 Score = 37.4 bits (85), Expect(2) = 1e-09 Identities = 14/22 (63%), Positives = 19/22 (86%) Frame = -3 Query: 421 EEKVMESMRAILGDDYYICRFQ 356 + K ++S+RA+ GDDYYICRFQ Sbjct: 136 KRKPIDSLRALFGDDYYICRFQ 157 >ref|XP_006355815.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum tuberosum] Length = 318 Score = 47.4 bits (111), Expect(2) = 2e-09 Identities = 20/31 (64%), Positives = 26/31 (83%) Frame = -1 Query: 504 MAWNFYLPRPDQIRALVNSSIMFQPRNPKRK 412 +AW+ L RPD+I+ALVN S++F PRNPKRK Sbjct: 107 IAWHVCLLRPDRIKALVNMSVVFHPRNPKRK 137 Score = 42.0 bits (97), Expect(2) = 2e-09 Identities = 17/24 (70%), Positives = 21/24 (87%) Frame = -3 Query: 421 EEKVMESMRAILGDDYYICRFQVF 350 + K +ESMRA+LGDDYYICRFQ + Sbjct: 135 KRKPIESMRAVLGDDYYICRFQEY 158 >ref|XP_004240550.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum lycopersicum] Length = 318 Score = 47.4 bits (111), Expect(2) = 2e-09 Identities = 20/31 (64%), Positives = 26/31 (83%) Frame = -1 Query: 504 MAWNFYLPRPDQIRALVNSSIMFQPRNPKRK 412 +AW+ L RPD+I+ALVN S++F PRNPKRK Sbjct: 107 IAWHVCLLRPDRIKALVNMSVVFHPRNPKRK 137 Score = 42.0 bits (97), Expect(2) = 2e-09 Identities = 17/24 (70%), Positives = 21/24 (87%) Frame = -3 Query: 421 EEKVMESMRAILGDDYYICRFQVF 350 + K +ESMRA+LGDDYYICRFQ + Sbjct: 135 KRKPIESMRAVLGDDYYICRFQEY 158 >ref|XP_012833716.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Erythranthe guttatus] gi|604348586|gb|EYU46741.1| hypothetical protein MIMGU_mgv1a009984mg [Erythranthe guttata] Length = 325 Score = 47.8 bits (112), Expect(2) = 6e-09 Identities = 21/31 (67%), Positives = 25/31 (80%) Frame = -1 Query: 504 MAWNFYLPRPDQIRALVNSSIMFQPRNPKRK 412 MAW L RPD+I+ALVN S++F PRNPKRK Sbjct: 106 MAWYLCLLRPDRIKALVNLSVVFHPRNPKRK 136 Score = 40.0 bits (92), Expect(2) = 6e-09 Identities = 17/22 (77%), Positives = 20/22 (90%) Frame = -3 Query: 421 EEKVMESMRAILGDDYYICRFQ 356 + K +ESMRAILG+DYYICRFQ Sbjct: 134 KRKPVESMRAILGNDYYICRFQ 155 >ref|XP_009620847.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana tomentosiformis] Length = 318 Score = 45.8 bits (107), Expect(2) = 6e-09 Identities = 19/31 (61%), Positives = 26/31 (83%) Frame = -1 Query: 504 MAWNFYLPRPDQIRALVNSSIMFQPRNPKRK 412 +AW+ L RPD+I+ALVN S++F PR+PKRK Sbjct: 107 IAWHLCLLRPDRIKALVNMSVVFHPRHPKRK 137 Score = 42.0 bits (97), Expect(2) = 6e-09 Identities = 17/24 (70%), Positives = 21/24 (87%) Frame = -3 Query: 421 EEKVMESMRAILGDDYYICRFQVF 350 + K +ESMRA+LGDDYYICRFQ + Sbjct: 135 KRKPIESMRAVLGDDYYICRFQEY 158 >ref|XP_014494768.1| PREDICTED: bifunctional epoxide hydrolase 2 [Vigna radiata var. radiata] Length = 317 Score = 48.9 bits (115), Expect(2) = 8e-09 Identities = 20/31 (64%), Positives = 27/31 (87%) Frame = -1 Query: 504 MAWNFYLPRPDQIRALVNSSIMFQPRNPKRK 412 +AW F L RPD+++ALVN S++F+PRNPKRK Sbjct: 106 VAWYFCLLRPDRVKALVNMSVVFRPRNPKRK 136 Score = 38.5 bits (88), Expect(2) = 8e-09 Identities = 15/22 (68%), Positives = 20/22 (90%) Frame = -3 Query: 421 EEKVMESMRAILGDDYYICRFQ 356 + K ++S+RA+LGDDYYICRFQ Sbjct: 134 KRKPIQSLRAMLGDDYYICRFQ 155 >emb|CDP17111.1| unnamed protein product [Coffea canephora] Length = 317 Score = 50.1 bits (118), Expect(2) = 1e-08 Identities = 22/31 (70%), Positives = 26/31 (83%) Frame = -1 Query: 504 MAWNFYLPRPDQIRALVNSSIMFQPRNPKRK 412 MAW F L RPD+I+ALVN S++F PRNPKRK Sbjct: 106 MAWYFCLLRPDRIKALVNMSVVFTPRNPKRK 136 Score = 37.0 bits (84), Expect(2) = 1e-08 Identities = 15/22 (68%), Positives = 18/22 (81%) Frame = -3 Query: 421 EEKVMESMRAILGDDYYICRFQ 356 + K +E+MRA GDDYYICRFQ Sbjct: 134 KRKPLEAMRARFGDDYYICRFQ 155 >ref|XP_009771842.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana sylvestris] Length = 318 Score = 44.7 bits (104), Expect(2) = 1e-08 Identities = 19/31 (61%), Positives = 25/31 (80%) Frame = -1 Query: 504 MAWNFYLPRPDQIRALVNSSIMFQPRNPKRK 412 +AW L RPD+I+ALVN S++F PR+PKRK Sbjct: 107 IAWYLCLLRPDRIKALVNMSVVFHPRHPKRK 137 Score = 42.0 bits (97), Expect(2) = 1e-08 Identities = 17/24 (70%), Positives = 21/24 (87%) Frame = -3 Query: 421 EEKVMESMRAILGDDYYICRFQVF 350 + K +ESMRA+LGDDYYICRFQ + Sbjct: 135 KRKPIESMRAVLGDDYYICRFQEY 158 >gb|KOM39452.1| hypothetical protein LR48_Vigan03g283400 [Vigna angularis] Length = 317 Score = 48.9 bits (115), Expect(2) = 1e-08 Identities = 20/31 (64%), Positives = 27/31 (87%) Frame = -1 Query: 504 MAWNFYLPRPDQIRALVNSSIMFQPRNPKRK 412 +AW F L RPD+++ALVN S++F+PRNPKRK Sbjct: 106 VAWYFCLLRPDRVKALVNMSVVFRPRNPKRK 136 Score = 37.7 bits (86), Expect(2) = 1e-08 Identities = 14/22 (63%), Positives = 20/22 (90%) Frame = -3 Query: 421 EEKVMESMRAILGDDYYICRFQ 356 + K ++S+RA++GDDYYICRFQ Sbjct: 134 KRKPIQSLRAMMGDDYYICRFQ 155 >ref|XP_003554527.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Glycine max] gi|947046828|gb|KRG96457.1| hypothetical protein GLYMA_19G211900 [Glycine max] Length = 317 Score = 48.1 bits (113), Expect(2) = 1e-08 Identities = 19/31 (61%), Positives = 27/31 (87%) Frame = -1 Query: 504 MAWNFYLPRPDQIRALVNSSIMFQPRNPKRK 412 +AW+F L RPD+++ALVN S++F+PRNP RK Sbjct: 106 IAWHFCLLRPDRVKALVNMSVVFRPRNPNRK 136 Score = 38.5 bits (88), Expect(2) = 1e-08 Identities = 15/20 (75%), Positives = 19/20 (95%) Frame = -3 Query: 415 KVMESMRAILGDDYYICRFQ 356 K ++S+RAI+GDDYYICRFQ Sbjct: 136 KPIQSLRAIMGDDYYICRFQ 155 >gb|KRG96458.1| hypothetical protein GLYMA_19G211900 [Glycine max] Length = 236 Score = 48.1 bits (113), Expect(2) = 1e-08 Identities = 19/31 (61%), Positives = 27/31 (87%) Frame = -1 Query: 504 MAWNFYLPRPDQIRALVNSSIMFQPRNPKRK 412 +AW+F L RPD+++ALVN S++F+PRNP RK Sbjct: 106 IAWHFCLLRPDRVKALVNMSVVFRPRNPNRK 136 Score = 38.5 bits (88), Expect(2) = 1e-08 Identities = 15/20 (75%), Positives = 19/20 (95%) Frame = -3 Query: 415 KVMESMRAILGDDYYICRFQ 356 K ++S+RAI+GDDYYICRFQ Sbjct: 136 KPIQSLRAIMGDDYYICRFQ 155 >ref|XP_007222693.1| hypothetical protein PRUPE_ppa008676mg [Prunus persica] gi|462419629|gb|EMJ23892.1| hypothetical protein PRUPE_ppa008676mg [Prunus persica] Length = 323 Score = 46.6 bits (109), Expect(2) = 5e-08 Identities = 20/33 (60%), Positives = 26/33 (78%) Frame = -1 Query: 507 FMAWNFYLPRPDQIRALVNSSIMFQPRNPKRKS 409 F+AW L RPD+++ALVN S+ F PRNP+RKS Sbjct: 110 FIAWYLCLFRPDRVKALVNMSVAFLPRNPQRKS 142 Score = 38.1 bits (87), Expect(2) = 5e-08 Identities = 14/22 (63%), Positives = 19/22 (86%) Frame = -3 Query: 421 EEKVMESMRAILGDDYYICRFQ 356 + K +ES++A+ GDDYYICRFQ Sbjct: 139 QRKSLESLKAVYGDDYYICRFQ 160 >ref|XP_007163124.1| hypothetical protein PHAVU_001G208300g [Phaseolus vulgaris] gi|561036588|gb|ESW35118.1| hypothetical protein PHAVU_001G208300g [Phaseolus vulgaris] Length = 317 Score = 47.0 bits (110), Expect(2) = 5e-08 Identities = 19/31 (61%), Positives = 27/31 (87%) Frame = -1 Query: 504 MAWNFYLPRPDQIRALVNSSIMFQPRNPKRK 412 +AW F L RP++++ALVN S++F+PRNPKRK Sbjct: 106 IAWYFCLLRPERLKALVNMSVVFRPRNPKRK 136 Score = 37.7 bits (86), Expect(2) = 5e-08 Identities = 14/22 (63%), Positives = 20/22 (90%) Frame = -3 Query: 421 EEKVMESMRAILGDDYYICRFQ 356 + K ++S+RA++GDDYYICRFQ Sbjct: 134 KRKPIQSLRAMMGDDYYICRFQ 155 >ref|XP_008355493.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Malus domestica] Length = 316 Score = 48.1 bits (113), Expect(2) = 5e-08 Identities = 21/31 (67%), Positives = 25/31 (80%) Frame = -1 Query: 504 MAWNFYLPRPDQIRALVNSSIMFQPRNPKRK 412 MAW F L RPD+++ALVN S+ F PRNPKRK Sbjct: 106 MAWWFCLFRPDRVKALVNMSVAFSPRNPKRK 136 Score = 36.6 bits (83), Expect(2) = 5e-08 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 5/51 (9%) Frame = -3 Query: 436 SAEESEEKVMESMRAILGDDYYICRFQ-----VFCFDSIIDF*LVIIRCFI 299 S + K +++ RA+ GDDYYICRFQ FDSI +++CF+ Sbjct: 129 SPRNPKRKPIDTFRALFGDDYYICRFQEPGEIEQDFDSIDT--AAVMKCFL 177 >ref|XP_007035641.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao] gi|508714670|gb|EOY06567.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao] Length = 396 Score = 45.8 bits (107), Expect(2) = 6e-08 Identities = 19/31 (61%), Positives = 25/31 (80%) Frame = -1 Query: 504 MAWNFYLPRPDQIRALVNSSIMFQPRNPKRK 412 +AW L RPD+++ALVN S++F PRNPKRK Sbjct: 181 IAWWLCLVRPDRVKALVNMSVVFSPRNPKRK 211 Score = 38.5 bits (88), Expect(2) = 6e-08 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = -3 Query: 436 SAEESEEKVMESMRAILGDDYYICRFQ 356 S + K +ES+RA GDDYYICRFQ Sbjct: 204 SPRNPKRKPLESLRAFYGDDYYICRFQ 230 >gb|KCW50060.1| hypothetical protein EUGRSUZ_K03501 [Eucalyptus grandis] Length = 332 Score = 44.7 bits (104), Expect(2) = 6e-08 Identities = 18/31 (58%), Positives = 26/31 (83%) Frame = -1 Query: 504 MAWNFYLPRPDQIRALVNSSIMFQPRNPKRK 412 MAW+ L RPD+++ALVN+S+ + PRNP+RK Sbjct: 107 MAWHLCLVRPDRVKALVNTSVAWFPRNPERK 137 Score = 39.7 bits (91), Expect(2) = 6e-08 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = -3 Query: 421 EEKVMESMRAILGDDYYICRFQ 356 E K +ESMRA GDDYY+CRFQ Sbjct: 135 ERKPVESMRATFGDDYYVCRFQ 156 >ref|XP_010038235.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus grandis] Length = 325 Score = 44.7 bits (104), Expect(2) = 6e-08 Identities = 18/31 (58%), Positives = 26/31 (83%) Frame = -1 Query: 504 MAWNFYLPRPDQIRALVNSSIMFQPRNPKRK 412 MAW+ L RPD+++ALVN+S+ + PRNP+RK Sbjct: 107 MAWHLCLVRPDRVKALVNTSVAWFPRNPERK 137 Score = 39.7 bits (91), Expect(2) = 6e-08 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = -3 Query: 421 EEKVMESMRAILGDDYYICRFQ 356 E K +ESMRA GDDYY+CRFQ Sbjct: 135 ERKPVESMRATFGDDYYVCRFQ 156