BLASTX nr result
ID: Perilla23_contig00016228
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00016228 (305 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011093116.1| PREDICTED: protein BPS1, chloroplastic-like ... 62 2e-07 ref|XP_006444975.1| hypothetical protein CICLE_v10020322mg [Citr... 57 7e-06 gb|KDO86272.1| hypothetical protein CISIN_1g014854mg [Citrus sin... 56 9e-06 ref|XP_006444974.1| hypothetical protein CICLE_v10020322mg [Citr... 56 9e-06 ref|XP_006294507.1| hypothetical protein CARUB_v10023538mg [Caps... 56 9e-06 >ref|XP_011093116.1| PREDICTED: protein BPS1, chloroplastic-like [Sesamum indicum] gi|747090821|ref|XP_011093118.1| PREDICTED: protein BPS1, chloroplastic-like [Sesamum indicum] gi|747090823|ref|XP_011093119.1| PREDICTED: protein BPS1, chloroplastic-like [Sesamum indicum] gi|747090825|ref|XP_011093120.1| PREDICTED: protein BPS1, chloroplastic-like [Sesamum indicum] Length = 353 Score = 61.6 bits (148), Expect = 2e-07 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 219 MSRPQDPHRTFLPFGNPFRMILPKGSSLS 305 MSRPQDPHR+FLPFGNPFRMILPKGS LS Sbjct: 1 MSRPQDPHRSFLPFGNPFRMILPKGSHLS 29 >ref|XP_006444975.1| hypothetical protein CICLE_v10020322mg [Citrus clementina] gi|557547237|gb|ESR58215.1| hypothetical protein CICLE_v10020322mg [Citrus clementina] Length = 419 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/38 (65%), Positives = 31/38 (81%), Gaps = 3/38 (7%) Frame = +3 Query: 201 LDLVHQ---MSRPQDPHRTFLPFGNPFRMILPKGSSLS 305 ++++H+ MSRPQDPHR F PFGNPFRM+ PKGS LS Sbjct: 1 MEIMHKSIKMSRPQDPHRPFFPFGNPFRMMSPKGSRLS 38 >gb|KDO86272.1| hypothetical protein CISIN_1g014854mg [Citrus sinensis] Length = 417 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +3 Query: 216 QMSRPQDPHRTFLPFGNPFRMILPKGSSLS 305 +MSRPQDPHR F PFGNPFRM+ PKGS LS Sbjct: 7 KMSRPQDPHRPFFPFGNPFRMMSPKGSRLS 36 >ref|XP_006444974.1| hypothetical protein CICLE_v10020322mg [Citrus clementina] gi|568876191|ref|XP_006491168.1| PREDICTED: protein BPS1, chloroplastic-like isoform X1 [Citrus sinensis] gi|557547236|gb|ESR58214.1| hypothetical protein CICLE_v10020322mg [Citrus clementina] gi|641867591|gb|KDO86275.1| hypothetical protein CISIN_1g014854mg [Citrus sinensis] Length = 358 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +3 Query: 216 QMSRPQDPHRTFLPFGNPFRMILPKGSSLS 305 +MSRPQDPHR F PFGNPFRM+ PKGS LS Sbjct: 7 KMSRPQDPHRPFFPFGNPFRMMSPKGSRLS 36 >ref|XP_006294507.1| hypothetical protein CARUB_v10023538mg [Capsella rubella] gi|482563215|gb|EOA27405.1| hypothetical protein CARUB_v10023538mg [Capsella rubella] Length = 350 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +3 Query: 219 MSRPQDPHRTFLPFGNPFRMILPKGSSLS 305 MSRPQDPHR F PFGNPFRM+ PKGS LS Sbjct: 1 MSRPQDPHRGFFPFGNPFRMLSPKGSDLS 29