BLASTX nr result
ID: Perilla23_contig00016212
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00016212 (306 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABR24417.1| nerolidol/linalool synthase 1 [Antirrhinum majus] 68 3e-09 gb|ABR24418.1| nerolidol/linalool synthase 2 [Antirrhinum majus] 67 4e-09 ref|XP_012842009.1| PREDICTED: tricyclene synthase 0e23, chlorop... 64 3e-08 ref|XP_012842008.1| PREDICTED: tricyclene synthase Oc15, chlorop... 64 3e-08 gb|EYU33926.1| hypothetical protein MIMGU_mgv1a004820mg [Erythra... 64 3e-08 ref|XP_011071312.1| PREDICTED: uncharacterized protein LOC105156... 64 4e-08 ref|XP_012842010.1| PREDICTED: tricyclene synthase Oc15, chlorop... 62 1e-07 ref|XP_011096135.1| PREDICTED: tricyclene synthase Oc15, chlorop... 62 2e-07 ref|XP_011096134.1| PREDICTED: tricyclene synthase Oc15, chlorop... 62 2e-07 sp|Q84NC8.1|TPS1_ANTMA RecName: Full=Tricyclene synthase 0e23, c... 61 4e-07 ref|XP_011096166.1| PREDICTED: tricyclene synthase Oc15, chlorop... 59 1e-06 ref|XP_011096219.1| PREDICTED: tricyclene synthase Oc15, chlorop... 58 2e-06 ref|XP_011096217.1| PREDICTED: tricyclene synthase Oc15, chlorop... 58 2e-06 gb|AER36088.1| nerolidol synthase [Actinidia chinensis] 57 4e-06 sp|Q84NC9.1|TPS3_ANTMA RecName: Full=Tricyclene synthase 1e20, c... 57 7e-06 sp|Q84ND0.1|TPS2_ANTMA RecName: Full=Tricyclene synthase Oc15, c... 57 7e-06 gb|ADD81294.1| linalool synthase [Actinidia arguta] 56 9e-06 >gb|ABR24417.1| nerolidol/linalool synthase 1 [Antirrhinum majus] Length = 566 Score = 67.8 bits (164), Expect = 3e-09 Identities = 28/62 (45%), Positives = 43/62 (69%) Frame = +3 Query: 6 FGIEKHEMQYRD*TCRWEYGAIDTLPEYMRTSYKAILDTTNGLALKVEEMYGTNPIDSLK 185 +G + + + + +W+Y A++TLP+YM+ YK++LDTTN + K+ E YG NPIDSLK Sbjct: 329 YGSPEELVIFAEAVSKWDYAAVETLPDYMKLCYKSLLDTTNEIGYKIYEKYGYNPIDSLK 388 Query: 186 AT 191 T Sbjct: 389 TT 390 >gb|ABR24418.1| nerolidol/linalool synthase 2 [Antirrhinum majus] Length = 596 Score = 67.4 bits (163), Expect = 4e-09 Identities = 27/47 (57%), Positives = 37/47 (78%) Frame = +3 Query: 51 RWEYGAIDTLPEYMRTSYKAILDTTNGLALKVEEMYGTNPIDSLKAT 191 +W+Y A++TLP+YM+ YK++LDTTN + K+ E YG NPIDSLK T Sbjct: 374 KWDYAAVETLPDYMKLCYKSLLDTTNEIGYKIYEKYGYNPIDSLKTT 420 >ref|XP_012842009.1| PREDICTED: tricyclene synthase 0e23, chloroplastic-like isoform X2 [Erythranthe guttatus] Length = 547 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/47 (59%), Positives = 37/47 (78%) Frame = +3 Query: 51 RWEYGAIDTLPEYMRTSYKAILDTTNGLALKVEEMYGTNPIDSLKAT 191 +W+Y AID LPEYM+ SYKA+LDTTN +A + E +G NPI++LK T Sbjct: 313 KWDYAAIDMLPEYMKMSYKALLDTTNEIARMIFEKHGHNPINTLKET 359 >ref|XP_012842008.1| PREDICTED: tricyclene synthase Oc15, chloroplastic-like isoform X1 [Erythranthe guttatus] Length = 583 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/47 (59%), Positives = 37/47 (78%) Frame = +3 Query: 51 RWEYGAIDTLPEYMRTSYKAILDTTNGLALKVEEMYGTNPIDSLKAT 191 +W+Y AID LPEYM+ SYKA+LDTTN +A + E +G NPI++LK T Sbjct: 349 KWDYAAIDMLPEYMKMSYKALLDTTNEIARMIFEKHGHNPINTLKET 395 >gb|EYU33926.1| hypothetical protein MIMGU_mgv1a004820mg [Erythranthe guttata] Length = 508 Score = 64.3 bits (155), Expect = 3e-08 Identities = 28/47 (59%), Positives = 37/47 (78%) Frame = +3 Query: 51 RWEYGAIDTLPEYMRTSYKAILDTTNGLALKVEEMYGTNPIDSLKAT 191 +W+Y AID LPEYM+ SYKA+LDTTN +A + E +G NPI++LK T Sbjct: 274 KWDYAAIDMLPEYMKMSYKALLDTTNEIARMIFEKHGHNPINTLKET 320 >ref|XP_011071312.1| PREDICTED: uncharacterized protein LOC105156792 [Sesamum indicum] Length = 1087 Score = 63.9 bits (154), Expect = 4e-08 Identities = 27/47 (57%), Positives = 37/47 (78%) Frame = +3 Query: 51 RWEYGAIDTLPEYMRTSYKAILDTTNGLALKVEEMYGTNPIDSLKAT 191 RW+Y A+D LP YMR SYKA+L TTN +A K+++++G NPI +KAT Sbjct: 285 RWDYSAVDMLPSYMRMSYKALLHTTNQIANKIQKLHGHNPIAYMKAT 331 Score = 62.8 bits (151), Expect = 1e-07 Identities = 28/47 (59%), Positives = 38/47 (80%) Frame = +3 Query: 51 RWEYGAIDTLPEYMRTSYKAILDTTNGLALKVEEMYGTNPIDSLKAT 191 RW+ AID LPEYMR SYKA++DTTN +A +++ +G NPI++LKAT Sbjct: 866 RWDDTAIDMLPEYMRMSYKALVDTTNEIAHNIKKKHGHNPINALKAT 912 >ref|XP_012842010.1| PREDICTED: tricyclene synthase Oc15, chloroplastic-like [Erythranthe guttatus] Length = 583 Score = 62.4 bits (150), Expect = 1e-07 Identities = 27/47 (57%), Positives = 36/47 (76%) Frame = +3 Query: 51 RWEYGAIDTLPEYMRTSYKAILDTTNGLALKVEEMYGTNPIDSLKAT 191 +W+Y AID LPEYM+ SYKA+LDT N +A + E +G NPI++LK T Sbjct: 350 KWDYAAIDMLPEYMKMSYKALLDTVNEIARMIFEKHGHNPINTLKET 396 >ref|XP_011096135.1| PREDICTED: tricyclene synthase Oc15, chloroplastic-like isoform X2 [Sesamum indicum] Length = 492 Score = 62.0 bits (149), Expect = 2e-07 Identities = 25/47 (53%), Positives = 37/47 (78%) Frame = +3 Query: 51 RWEYGAIDTLPEYMRTSYKAILDTTNGLALKVEEMYGTNPIDSLKAT 191 +WEY AID LP+YM+ Y+A+LDTTNG+ ++ + +G +PIDSLK + Sbjct: 352 KWEYAAIDMLPDYMKMCYRALLDTTNGIGHEIYKRHGYDPIDSLKTS 398 >ref|XP_011096134.1| PREDICTED: tricyclene synthase Oc15, chloroplastic-like isoform X1 [Sesamum indicum] Length = 525 Score = 62.0 bits (149), Expect = 2e-07 Identities = 25/47 (53%), Positives = 37/47 (78%) Frame = +3 Query: 51 RWEYGAIDTLPEYMRTSYKAILDTTNGLALKVEEMYGTNPIDSLKAT 191 +WEY AID LP+YM+ Y+A+LDTTNG+ ++ + +G +PIDSLK + Sbjct: 352 KWEYAAIDMLPDYMKMCYRALLDTTNGIGHEIYKRHGYDPIDSLKTS 398 >sp|Q84NC8.1|TPS1_ANTMA RecName: Full=Tricyclene synthase 0e23, chloroplastic; Short=Am0e23; AltName: Full=(E)-beta-ocimene synthase 0e23; AltName: Full=Terpenoid synthase 0e23; Flags: Precursor [Antirrhinum majus] gi|30349140|gb|AAO42614.1| (E)-b-ocimene synthase [Antirrhinum majus] Length = 579 Score = 60.8 bits (146), Expect = 4e-07 Identities = 26/47 (55%), Positives = 33/47 (70%) Frame = +3 Query: 51 RWEYGAIDTLPEYMRTSYKAILDTTNGLALKVEEMYGTNPIDSLKAT 191 +W+Y A DTLP+ M+ Y +LDT NG + K+ E YG NPIDSLK T Sbjct: 357 KWDYSATDTLPDNMKMCYMTLLDTINGTSQKIYEKYGHNPIDSLKTT 403 >ref|XP_011096166.1| PREDICTED: tricyclene synthase Oc15, chloroplastic-like [Sesamum indicum] Length = 583 Score = 59.3 bits (142), Expect = 1e-06 Identities = 23/47 (48%), Positives = 36/47 (76%) Frame = +3 Query: 51 RWEYGAIDTLPEYMRTSYKAILDTTNGLALKVEEMYGTNPIDSLKAT 191 +WEY A++ LP+YM+ Y+A+LDTTN + ++ + +G NPIDSLK + Sbjct: 355 KWEYAAVNMLPDYMKMCYRALLDTTNDIGREIYKRHGHNPIDSLKTS 401 >ref|XP_011096219.1| PREDICTED: tricyclene synthase Oc15, chloroplastic-like [Sesamum indicum] Length = 572 Score = 58.2 bits (139), Expect = 2e-06 Identities = 22/47 (46%), Positives = 37/47 (78%) Frame = +3 Query: 51 RWEYGAIDTLPEYMRTSYKAILDTTNGLALKVEEMYGTNPIDSLKAT 191 +W+Y A+D LP+YM+ Y+A+LDTTN ++ ++ + +G NPI+SLK + Sbjct: 347 KWDYAAVDMLPDYMKMCYRALLDTTNDISHEIYKRHGHNPINSLKTS 393 >ref|XP_011096217.1| PREDICTED: tricyclene synthase Oc15, chloroplastic-like [Sesamum indicum] Length = 576 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/47 (51%), Positives = 36/47 (76%) Frame = +3 Query: 51 RWEYGAIDTLPEYMRTSYKAILDTTNGLALKVEEMYGTNPIDSLKAT 191 +W+Y AID LP+YM+ Y+A+LDTTN + +V + +G +PIDSLK + Sbjct: 353 KWDYAAIDMLPDYMKMCYRALLDTTNRIGHEVYKRHGYDPIDSLKTS 399 >gb|AER36088.1| nerolidol synthase [Actinidia chinensis] Length = 573 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/53 (45%), Positives = 36/53 (67%) Frame = +3 Query: 33 YRD*TCRWEYGAIDTLPEYMRTSYKAILDTTNGLALKVEEMYGTNPIDSLKAT 191 + D RWE A++ LP+YM+ +KA+ D TN +A K+ + +G NPIDSL+ T Sbjct: 343 FTDAVNRWELSAVEQLPDYMKVCFKALYDVTNEIAYKIYKKHGQNPIDSLQKT 395 >sp|Q84NC9.1|TPS3_ANTMA RecName: Full=Tricyclene synthase 1e20, chloroplastic; Short=Am1e20; AltName: Full=Myrcene synthase 1e20; AltName: Full=Terpenoid synthase 1e20; Flags: Precursor [Antirrhinum majus] gi|30349144|gb|AAO41727.1| myrcene synthase 1e20 [Antirrhinum majus] Length = 584 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/47 (53%), Positives = 32/47 (68%) Frame = +3 Query: 51 RWEYGAIDTLPEYMRTSYKAILDTTNGLALKVEEMYGTNPIDSLKAT 191 +W+Y A DTLPE M+ +LDT NG + K+ E +G NPIDSLK T Sbjct: 362 KWDYSATDTLPENMKMCCMTLLDTINGTSQKIYEKHGYNPIDSLKTT 408 >sp|Q84ND0.1|TPS2_ANTMA RecName: Full=Tricyclene synthase Oc15, chloroplastic; Short=AmOc15; AltName: Full=Myrcene synthase Oc15; AltName: Full=Terpenoid synthase Oc15; Flags: Precursor [Antirrhinum majus] gi|30349142|gb|AAO41726.1| myrcene synthase Oc15 [Antirrhinum majus] Length = 581 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/47 (53%), Positives = 32/47 (68%) Frame = +3 Query: 51 RWEYGAIDTLPEYMRTSYKAILDTTNGLALKVEEMYGTNPIDSLKAT 191 +W+Y A DTLPE M+ +LDT NG + K+ E +G NPIDSLK T Sbjct: 359 KWDYSATDTLPENMKMCCMTLLDTINGTSQKIYEKHGYNPIDSLKTT 405 >gb|ADD81294.1| linalool synthase [Actinidia arguta] Length = 574 Score = 56.2 bits (134), Expect = 9e-06 Identities = 24/53 (45%), Positives = 36/53 (67%) Frame = +3 Query: 33 YRD*TCRWEYGAIDTLPEYMRTSYKAILDTTNGLALKVEEMYGTNPIDSLKAT 191 + D RWE A++ LP+YM+ +KA+ D TN +A K+ + +G NPIDSL+ T Sbjct: 344 FTDAVNRWELTAVEQLPDYMKICFKALYDITNEIAYKIYKKHGRNPIDSLRRT 396