BLASTX nr result
ID: Perilla23_contig00016128
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00016128 (665 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS73572.1| hypothetical protein M569_01187, partial [Genlise... 58 6e-06 >gb|EPS73572.1| hypothetical protein M569_01187, partial [Genlisea aurea] Length = 94 Score = 57.8 bits (138), Expect = 6e-06 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -3 Query: 567 DTNASASSHGKVDGIARWFGTSVVAAFFASLERCSC 460 + N+ S +GKVDG ARW GTSV AAFFASLERCSC Sbjct: 3 EENSDDSYYGKVDGFARWLGTSVSAAFFASLERCSC 38