BLASTX nr result
ID: Perilla23_contig00015786
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00015786 (375 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011078028.1| PREDICTED: putative nuclease HARBI1 [Sesamum... 89 1e-15 >ref|XP_011078028.1| PREDICTED: putative nuclease HARBI1 [Sesamum indicum] Length = 489 Score = 89.0 bits (219), Expect = 1e-15 Identities = 45/95 (47%), Positives = 68/95 (71%), Gaps = 4/95 (4%) Frame = -2 Query: 275 QDSEPGIISFSAAKKRPRFDD----DSSIEDVISKLLAFDAPVEQKPLENVYAAPQNSVL 108 QDS+PG ISFS KKRPR+DD D S++++++KLLAFD+P E+K + Y +S+L Sbjct: 20 QDSDPGFISFSNTKKRPRYDDSIENDPSVQELLTKLLAFDSPPEEKETRDAY----DSIL 75 Query: 107 MNWNHNQSKQEMADSSYGFNGYPSVPHSGNSKRAR 3 M+ N+N+S QE+ +S+ NGYP++ SG S +A+ Sbjct: 76 MDSNYNRSNQELNESAVYCNGYPNLSDSGISPQAK 110