BLASTX nr result
ID: Perilla23_contig00015754
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00015754 (381 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012830068.1| PREDICTED: uncharacterized protein LOC105951... 58 2e-06 gb|EYU43086.1| hypothetical protein MIMGU_mgv1a003592mg [Erythra... 58 2e-06 >ref|XP_012830068.1| PREDICTED: uncharacterized protein LOC105951228 [Erythranthe guttatus] Length = 675 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = -2 Query: 380 PSGMKTTAVGHQF-DISSKVQSLRSDFSFPRSRSEGNLGAL 261 P+GMKT GH+ D+S +V SLR+DFSFPRSRSEGNLG L Sbjct: 635 PTGMKTATQGHELTDLSKRVLSLRNDFSFPRSRSEGNLGGL 675 >gb|EYU43086.1| hypothetical protein MIMGU_mgv1a003592mg [Erythranthe guttata] Length = 575 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = -2 Query: 380 PSGMKTTAVGHQF-DISSKVQSLRSDFSFPRSRSEGNLGAL 261 P+GMKT GH+ D+S +V SLR+DFSFPRSRSEGNLG L Sbjct: 535 PTGMKTATQGHELTDLSKRVLSLRNDFSFPRSRSEGNLGGL 575