BLASTX nr result
ID: Perilla23_contig00015691
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00015691 (403 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KCW67492.1| hypothetical protein EUGRSUZ_F012262, partial [Eu... 89 2e-15 ref|XP_006370167.1| ubiquitin-conjugating enzyme family protein ... 89 2e-15 gb|ABK22122.1| unknown [Picea sitchensis] 89 2e-15 ref|XP_010924615.1| PREDICTED: ubiquitin-conjugating enzyme E2 3... 87 4e-15 gb|AAF22280.1|AF165420_1 ubiquitin-conjugating enzyme [Mesembrya... 87 4e-15 gb|KNA04896.1| hypothetical protein SOVF_195450 [Spinacia oleracea] 87 5e-15 ref|XP_012441222.1| PREDICTED: ubiquitin-conjugating enzyme E2 3... 87 5e-15 ref|XP_012464625.1| PREDICTED: ubiquitin-conjugating enzyme E2 3... 87 5e-15 ref|XP_012441224.1| PREDICTED: ubiquitin-conjugating enzyme E2 3... 87 5e-15 gb|KHG29378.1| Ubiquitin-conjugating enzyme E2 35 -like protein ... 87 5e-15 ref|XP_010279114.1| PREDICTED: ubiquitin-conjugating enzyme E2 3... 87 5e-15 ref|XP_010277057.1| PREDICTED: ubiquitin-conjugating enzyme E2 3... 87 5e-15 ref|XP_006442524.1| hypothetical protein CICLE_v10022662mg [Citr... 87 5e-15 ref|XP_006442523.1| hypothetical protein CICLE_v10022662mg [Citr... 87 5e-15 ref|XP_006442521.1| hypothetical protein CICLE_v10022662mg [Citr... 87 5e-15 ref|XP_006442519.1| hypothetical protein CICLE_v10022662mg [Citr... 87 5e-15 ref|XP_007021721.1| Ubiquitin-conjugating enzyme 36 isoform 1 [T... 87 5e-15 ref|NP_001274306.1| ubiquitin-conjugating enzyme E2 35-like [Sol... 87 5e-15 gb|AFN85541.1| ubiquitin-conjugating enzyme, partial [Olea europ... 87 5e-15 ref|NP_001275211.1| ubiquitin-conjugating enzyme E2 36-like [Sol... 87 5e-15 >gb|KCW67492.1| hypothetical protein EUGRSUZ_F012262, partial [Eucalyptus grandis] gi|629102024|gb|KCW67493.1| hypothetical protein EUGRSUZ_F012262, partial [Eucalyptus grandis] Length = 83 Score = 88.6 bits (218), Expect = 2e-15 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = -2 Query: 402 LLSAPNPDDPLSENIAKHWKTNEVEAVETAKEWTRLYASGA 280 LLSAPNPDDPLSENIAKHWKTNEVEAVETAKEWTRLYASGA Sbjct: 43 LLSAPNPDDPLSENIAKHWKTNEVEAVETAKEWTRLYASGA 83 >ref|XP_006370167.1| ubiquitin-conjugating enzyme family protein [Populus trichocarpa] gi|702365634|ref|XP_010060692.1| PREDICTED: ubiquitin-conjugating enzyme E2 36 [Eucalyptus grandis] gi|703144260|ref|XP_010108244.1| Ubiquitin-conjugating enzyme E2 35 [Morus notabilis] gi|118482721|gb|ABK93279.1| unknown [Populus trichocarpa] gi|118483536|gb|ABK93666.1| unknown [Populus trichocarpa] gi|118484632|gb|ABK94188.1| unknown [Populus trichocarpa] gi|118484964|gb|ABK94347.1| unknown [Populus trichocarpa] gi|550349346|gb|ERP66736.1| ubiquitin-conjugating enzyme family protein [Populus trichocarpa] gi|587931397|gb|EXC18484.1| Ubiquitin-conjugating enzyme E2 35 [Morus notabilis] Length = 153 Score = 88.6 bits (218), Expect = 2e-15 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = -2 Query: 402 LLSAPNPDDPLSENIAKHWKTNEVEAVETAKEWTRLYASGA 280 LLSAPNPDDPLSENIAKHWKTNEVEAVETAKEWTRLYASGA Sbjct: 113 LLSAPNPDDPLSENIAKHWKTNEVEAVETAKEWTRLYASGA 153 >gb|ABK22122.1| unknown [Picea sitchensis] Length = 153 Score = 88.6 bits (218), Expect = 2e-15 Identities = 41/41 (100%), Positives = 41/41 (100%) Frame = -2 Query: 402 LLSAPNPDDPLSENIAKHWKTNEVEAVETAKEWTRLYASGA 280 LLSAPNPDDPLSENIAKHWKTNEVEAVETAKEWTRLYASGA Sbjct: 113 LLSAPNPDDPLSENIAKHWKTNEVEAVETAKEWTRLYASGA 153 >ref|XP_010924615.1| PREDICTED: ubiquitin-conjugating enzyme E2 36 [Elaeis guineensis] Length = 153 Score = 87.4 bits (215), Expect = 4e-15 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -2 Query: 402 LLSAPNPDDPLSENIAKHWKTNEVEAVETAKEWTRLYASGA 280 LLSAPNPDDPLS+NIAKHWKTNEVEAVETAKEWTRLYASGA Sbjct: 113 LLSAPNPDDPLSDNIAKHWKTNEVEAVETAKEWTRLYASGA 153 >gb|AAF22280.1|AF165420_1 ubiquitin-conjugating enzyme [Mesembryanthemum crystallinum] Length = 89 Score = 87.4 bits (215), Expect = 4e-15 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -2 Query: 402 LLSAPNPDDPLSENIAKHWKTNEVEAVETAKEWTRLYASGA 280 LLSAPNPDDPLSENIAKHWKTNEVEAVETAKEWTRLYA+GA Sbjct: 49 LLSAPNPDDPLSENIAKHWKTNEVEAVETAKEWTRLYATGA 89 >gb|KNA04896.1| hypothetical protein SOVF_195450 [Spinacia oleracea] Length = 153 Score = 87.0 bits (214), Expect = 5e-15 Identities = 39/41 (95%), Positives = 41/41 (100%) Frame = -2 Query: 402 LLSAPNPDDPLSENIAKHWKTNEVEAVETAKEWTRLYASGA 280 LLSAPNPDDPLSENIAKHWKTNE+EAVETAKEWTRLYA+GA Sbjct: 113 LLSAPNPDDPLSENIAKHWKTNEIEAVETAKEWTRLYANGA 153 >ref|XP_012441222.1| PREDICTED: ubiquitin-conjugating enzyme E2 36-like isoform X1 [Gossypium raimondii] Length = 185 Score = 87.0 bits (214), Expect = 5e-15 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -2 Query: 402 LLSAPNPDDPLSENIAKHWKTNEVEAVETAKEWTRLYASGA 280 LLSAPNPDDPLSENIAKHWKTNE EAVETAKEWTRLYASGA Sbjct: 145 LLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYASGA 185 >ref|XP_012464625.1| PREDICTED: ubiquitin-conjugating enzyme E2 36-like isoform X1 [Gossypium raimondii] gi|763815188|gb|KJB82040.1| hypothetical protein B456_013G173200 [Gossypium raimondii] Length = 158 Score = 87.0 bits (214), Expect = 5e-15 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -2 Query: 402 LLSAPNPDDPLSENIAKHWKTNEVEAVETAKEWTRLYASGA 280 LLSAPNPDDPLSENIAKHWKTNE EAVETAKEWTRLYASGA Sbjct: 118 LLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYASGA 158 >ref|XP_012441224.1| PREDICTED: ubiquitin-conjugating enzyme E2 36-like isoform X3 [Gossypium raimondii] gi|763794590|gb|KJB61586.1| hypothetical protein B456_009G368300 [Gossypium raimondii] Length = 153 Score = 87.0 bits (214), Expect = 5e-15 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -2 Query: 402 LLSAPNPDDPLSENIAKHWKTNEVEAVETAKEWTRLYASGA 280 LLSAPNPDDPLSENIAKHWKTNE EAVETAKEWTRLYASGA Sbjct: 113 LLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYASGA 153 >gb|KHG29378.1| Ubiquitin-conjugating enzyme E2 35 -like protein [Gossypium arboreum] Length = 157 Score = 87.0 bits (214), Expect = 5e-15 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -2 Query: 402 LLSAPNPDDPLSENIAKHWKTNEVEAVETAKEWTRLYASGA 280 LLSAPNPDDPLSENIAKHWKTNE EAVETAKEWTRLYASGA Sbjct: 117 LLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYASGA 157 >ref|XP_010279114.1| PREDICTED: ubiquitin-conjugating enzyme E2 36 [Nelumbo nucifera] Length = 153 Score = 87.0 bits (214), Expect = 5e-15 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -2 Query: 402 LLSAPNPDDPLSENIAKHWKTNEVEAVETAKEWTRLYASGA 280 LLSAPNPDDPLSENIAKHWKTNE EAVETAKEWTRLYASGA Sbjct: 113 LLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYASGA 153 >ref|XP_010277057.1| PREDICTED: ubiquitin-conjugating enzyme E2 36-like [Nelumbo nucifera] Length = 153 Score = 87.0 bits (214), Expect = 5e-15 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -2 Query: 402 LLSAPNPDDPLSENIAKHWKTNEVEAVETAKEWTRLYASGA 280 LLSAPNPDDPLSENIAKHWKTNE EAVETAKEWTRLYASGA Sbjct: 113 LLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYASGA 153 >ref|XP_006442524.1| hypothetical protein CICLE_v10022662mg [Citrus clementina] gi|557544786|gb|ESR55764.1| hypothetical protein CICLE_v10022662mg [Citrus clementina] gi|763815189|gb|KJB82041.1| hypothetical protein B456_013G173200 [Gossypium raimondii] Length = 120 Score = 87.0 bits (214), Expect = 5e-15 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -2 Query: 402 LLSAPNPDDPLSENIAKHWKTNEVEAVETAKEWTRLYASGA 280 LLSAPNPDDPLSENIAKHWKTNE EAVETAKEWTRLYASGA Sbjct: 80 LLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYASGA 120 >ref|XP_006442523.1| hypothetical protein CICLE_v10022662mg [Citrus clementina] gi|557544785|gb|ESR55763.1| hypothetical protein CICLE_v10022662mg [Citrus clementina] Length = 151 Score = 87.0 bits (214), Expect = 5e-15 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -2 Query: 402 LLSAPNPDDPLSENIAKHWKTNEVEAVETAKEWTRLYASGA 280 LLSAPNPDDPLSENIAKHWKTNE EAVETAKEWTRLYASGA Sbjct: 111 LLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYASGA 151 >ref|XP_006442521.1| hypothetical protein CICLE_v10022662mg [Citrus clementina] gi|557544783|gb|ESR55761.1| hypothetical protein CICLE_v10022662mg [Citrus clementina] gi|641825367|gb|KDO44640.1| hypothetical protein CISIN_1g031783mg [Citrus sinensis] Length = 139 Score = 87.0 bits (214), Expect = 5e-15 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -2 Query: 402 LLSAPNPDDPLSENIAKHWKTNEVEAVETAKEWTRLYASGA 280 LLSAPNPDDPLSENIAKHWKTNE EAVETAKEWTRLYASGA Sbjct: 99 LLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYASGA 139 >ref|XP_006442519.1| hypothetical protein CICLE_v10022662mg [Citrus clementina] gi|557544781|gb|ESR55759.1| hypothetical protein CICLE_v10022662mg [Citrus clementina] gi|641825369|gb|KDO44642.1| hypothetical protein CISIN_1g031783mg [Citrus sinensis] Length = 143 Score = 87.0 bits (214), Expect = 5e-15 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -2 Query: 402 LLSAPNPDDPLSENIAKHWKTNEVEAVETAKEWTRLYASGA 280 LLSAPNPDDPLSENIAKHWKTNE EAVETAKEWTRLYASGA Sbjct: 103 LLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYASGA 143 >ref|XP_007021721.1| Ubiquitin-conjugating enzyme 36 isoform 1 [Theobroma cacao] gi|508721349|gb|EOY13246.1| Ubiquitin-conjugating enzyme 36 isoform 1 [Theobroma cacao] Length = 204 Score = 87.0 bits (214), Expect = 5e-15 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -2 Query: 402 LLSAPNPDDPLSENIAKHWKTNEVEAVETAKEWTRLYASGA 280 LLSAPNPDDPLSENIAKHWKTNE EAVETAKEWTRLYASGA Sbjct: 164 LLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYASGA 204 >ref|NP_001274306.1| ubiquitin-conjugating enzyme E2 35-like [Solanum lycopersicum] gi|502089837|ref|XP_004489035.1| PREDICTED: ubiquitin-conjugating enzyme E2 35 [Cicer arietinum] gi|557880981|gb|AHA42248.1| Fen-interacting protein 3 [Solanum lycopersicum] Length = 153 Score = 87.0 bits (214), Expect = 5e-15 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -2 Query: 402 LLSAPNPDDPLSENIAKHWKTNEVEAVETAKEWTRLYASGA 280 LLSAPNPDDPLSENIAKHWK+NEVEAVETAKEWTRLYASGA Sbjct: 113 LLSAPNPDDPLSENIAKHWKSNEVEAVETAKEWTRLYASGA 153 >gb|AFN85541.1| ubiquitin-conjugating enzyme, partial [Olea europaea] Length = 90 Score = 87.0 bits (214), Expect = 5e-15 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -2 Query: 402 LLSAPNPDDPLSENIAKHWKTNEVEAVETAKEWTRLYASGA 280 LLSAPNPDDPLSENIAKHWKTNE EAVETAKEWTRLYASGA Sbjct: 50 LLSAPNPDDPLSENIAKHWKTNEAEAVETAKEWTRLYASGA 90 >ref|NP_001275211.1| ubiquitin-conjugating enzyme E2 36-like [Solanum tuberosum] gi|388496308|gb|AFK36220.1| unknown [Lotus japonicus] gi|418730406|gb|AFX66994.1| ubiquitin-conjugating enzyme E2 36 [Solanum tuberosum] Length = 153 Score = 87.0 bits (214), Expect = 5e-15 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -2 Query: 402 LLSAPNPDDPLSENIAKHWKTNEVEAVETAKEWTRLYASGA 280 LLSAPNPDDPLSENIAKHWK+NEVEAVETAKEWTRLYASGA Sbjct: 113 LLSAPNPDDPLSENIAKHWKSNEVEAVETAKEWTRLYASGA 153