BLASTX nr result
ID: Perilla23_contig00015570
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00015570 (377 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011091448.1| PREDICTED: putative disease resistance prote... 58 3e-06 ref|XP_011091703.1| PREDICTED: disease resistance protein RPP8-l... 57 5e-06 >ref|XP_011091448.1| PREDICTED: putative disease resistance protein At1g50180 [Sesamum indicum] Length = 653 Score = 57.8 bits (138), Expect = 3e-06 Identities = 43/131 (32%), Positives = 68/131 (51%), Gaps = 7/131 (5%) Frame = -3 Query: 375 ELASRCMLQVE----DISPEWRKCKLHDVVREFCLSTGKKEEFGVQVLEYRDGNFGSLLP 208 ELA++CM+QVE I ++ C+LHD++R+ CL GK+E F ++V++ + Sbjct: 512 ELANKCMIQVEMHERSIYSRYKSCRLHDLMRDLCLLKGKEEGF-IEVVDRQTRR------ 564 Query: 207 VASQSINKTRHLAIHFPAEVIRPEGGGDLTISN---CERLRSLEILTQSRWYYIQFPPES 37 SI KT LAIH + GD I N + LRSL + + +W YI + Sbjct: 565 ADESSICKTTRLAIHL-------DELGDSHIQNIGKSKNLRSL-LFLRKQWQYIDWNHSE 616 Query: 36 IIDFEKFKVLR 4 ++F FK ++ Sbjct: 617 GLNFGIFKFMK 627 >ref|XP_011091703.1| PREDICTED: disease resistance protein RPP8-like [Sesamum indicum] Length = 857 Score = 57.0 bits (136), Expect = 5e-06 Identities = 35/75 (46%), Positives = 43/75 (57%), Gaps = 4/75 (5%) Frame = -3 Query: 375 ELASRCMLQVE----DISPEWRKCKLHDVVREFCLSTGKKEEFGVQVLEYRDGNFGSLLP 208 ELA RCM+QVE + ++ C+LHD++R+ CLS GKKE F LE D GS Sbjct: 469 ELAKRCMVQVEIDELPLYNRFKSCRLHDMIRDLCLSKGKKEGF----LEVIDREMGS--- 521 Query: 207 VASQSINKTRHLAIH 163 SI KT LAIH Sbjct: 522 -EESSICKTNRLAIH 535 Database: ./nr Posted date: Nov 25, 2015 3:41 PM Number of letters in database: 28,104,191,420 Number of sequences in database: 77,306,371 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 77306371 Number of Hits to DB: 704,629,288,360,951 Number of extensions: 538849219 Number of successful extensions: -1175344065 Number of sequences better than 1.0e-05: 163332890 Number of HSP's gapped: -1774679201 Number of HSP's successfully gapped: 212418639 Length of database: 28,104,191,420 Neighboring words threshold: 12 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 29 (15.8 bits)