BLASTX nr result
ID: Perilla23_contig00015188
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00015188 (1165 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011095342.1| PREDICTED: serine/arginine-rich splicing fac... 72 9e-10 ref|XP_012855043.1| PREDICTED: RNA-binding protein 7 [Erythranth... 63 4e-07 >ref|XP_011095342.1| PREDICTED: serine/arginine-rich splicing factor SC35 [Sesamum indicum] Length = 265 Score = 72.0 bits (175), Expect = 9e-10 Identities = 32/53 (60%), Positives = 41/53 (77%) Frame = -3 Query: 899 DISVPRSNGYRSYHDSTDYSYSRRVFGSVVDSVSHASSRSYEMHDSINRNPYY 741 D S+ + NGYRSYHD+TDY+YSRRVFG+ +DSVS + S YE +S+N NP Y Sbjct: 213 DKSMQQPNGYRSYHDNTDYNYSRRVFGAALDSVSRSRSGRYETRNSVNYNPSY 265 >ref|XP_012855043.1| PREDICTED: RNA-binding protein 7 [Erythranthe guttatus] gi|604303231|gb|EYU22704.1| hypothetical protein MIMGU_mgv1a014187mg [Erythranthe guttata] Length = 198 Score = 63.2 bits (152), Expect = 4e-07 Identities = 33/54 (61%), Positives = 41/54 (75%), Gaps = 1/54 (1%) Frame = -3 Query: 899 DISVPRSNGYRSYHDSTDY-SYSRRVFGSVVDSVSHASSRSYEMHDSINRNPYY 741 DISV +SNGYRSY+ STDY +YS RVFG+V+DSVS +SS YE S++ N Y Sbjct: 145 DISVHQSNGYRSYNKSTDYKNYSGRVFGAVLDSVSRSSSSRYETRKSMHYNSSY 198