BLASTX nr result
ID: Perilla23_contig00015086
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00015086 (422 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011089730.1| PREDICTED: serine/arginine-rich SC35-like sp... 70 5e-10 ref|XP_011089133.1| PREDICTED: serine/arginine-rich SC35-like sp... 68 2e-09 ref|XP_012835288.1| PREDICTED: serine/arginine-rich SC35-like sp... 62 2e-07 >ref|XP_011089730.1| PREDICTED: serine/arginine-rich SC35-like splicing factor SCL30A [Sesamum indicum] Length = 265 Score = 70.5 bits (171), Expect = 5e-10 Identities = 53/110 (48%), Positives = 55/110 (50%), Gaps = 1/110 (0%) Frame = -2 Query: 421 AEENRKKPTEMRARERGSSRGRVYDXXXXXXXXXXXXXXXXXXXXXXXXXXXXRERDYYS 242 AEENRKKPTEMRARERG RGRVYD R RDYYS Sbjct: 110 AEENRKKPTEMRARERG-GRGRVYD-RRRSPPRYSRSPRYSRSPPPHYGRSPSRSRDYYS 167 Query: 241 -PKRRYSRSVXXXXXXXXXXXXXXXXXXXREHSPTYDGPPRNRSGSPVRE 95 PKRRYSRSV R+HSP Y+G PRN SGSP RE Sbjct: 168 PPKRRYSRSV-SPRDKRYSRERSYSRSPARDHSPPYNG-PRNHSGSPARE 215 >ref|XP_011089133.1| PREDICTED: serine/arginine-rich SC35-like splicing factor SCL33 [Sesamum indicum] Length = 263 Score = 68.2 bits (165), Expect = 2e-09 Identities = 52/110 (47%), Positives = 54/110 (49%), Gaps = 1/110 (0%) Frame = -2 Query: 421 AEENRKKPTEMRARERGSSRGRVYDXXXXXXXXXXXXXXXXXXXXXXXXXXXXRERDYYS 242 AEENRKKPTEMRARERG RGRV+D R DYYS Sbjct: 110 AEENRKKPTEMRARERG-GRGRVHD-RRRSPPRYSRSPRYSQSPPPRHGRSRSRNHDYYS 167 Query: 241 -PKRRYSRSVXXXXXXXXXXXXXXXXXXXREHSPTYDGPPRNRSGSPVRE 95 PKRRYSRS+ RE SP YDG PRN SGSPVRE Sbjct: 168 PPKRRYSRSI-SPREKRYSRERSLSHTPLRERSPAYDG-PRNHSGSPVRE 215 >ref|XP_012835288.1| PREDICTED: serine/arginine-rich SC35-like splicing factor SCL30A [Erythranthe guttatus] gi|604335310|gb|EYU39252.1| hypothetical protein MIMGU_mgv1a012161mg [Erythranthe guttata] Length = 259 Score = 62.0 bits (149), Expect = 2e-07 Identities = 49/110 (44%), Positives = 50/110 (45%), Gaps = 1/110 (0%) Frame = -2 Query: 421 AEENRKKPTEMRARERGSSRGRVYDXXXXXXXXXXXXXXXXXXXXXXXXXXXXRERDYYS 242 AEENRKKPTEMR+RER S R YD R DYYS Sbjct: 110 AEENRKKPTEMRSRER-SVRSSDYD-RRRSPPRYSRSPRYSRSPPPRYGRSHSRNHDYYS 167 Query: 241 -PKRRYSRSVXXXXXXXXXXXXXXXXXXXREHSPTYDGPPRNRSGSPVRE 95 PKRRYSRSV HSP YDG PRNR GSPVRE Sbjct: 168 PPKRRYSRSV-------SPYERRYSRERSYSHSPAYDG-PRNRGGSPVRE 209