BLASTX nr result
ID: Perilla23_contig00014461
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00014461 (488 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012849766.1| PREDICTED: disease resistance RPP13-like pro... 67 7e-09 >ref|XP_012849766.1| PREDICTED: disease resistance RPP13-like protein 4 [Erythranthe guttatus] gi|604314129|gb|EYU27016.1| hypothetical protein MIMGU_mgv1a024702mg [Erythranthe guttata] Length = 581 Score = 66.6 bits (161), Expect = 7e-09 Identities = 44/96 (45%), Positives = 56/96 (58%) Frame = -2 Query: 292 MLVRKKPEKAAPVLLDRLSKIKDHAMKVLDIDLADENHNPELNSKFDGIESKLKRMADSL 113 M +RKKPE+A VLL RL K K+ A + + L KF+ IE +L + + Sbjct: 1 MSIRKKPEEAVSVLLGRLKKAKEAA--------TENAVDSCLVFKFNEIEKELNGIKEFY 52 Query: 112 SKTKNWEKRVADQLCALEQVLDHEILTFKDDPEMES 5 K K+WEK V DQ CALEQ LD +I FK DPEME+ Sbjct: 53 PKIKSWEKGVTDQFCALEQGLDDDI--FK-DPEMET 85