BLASTX nr result
ID: Perilla23_contig00013335
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00013335 (1199 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS64483.1| hypothetical protein M569_10301, partial [Genlise... 64 2e-07 ref|XP_011075949.1| PREDICTED: sarcoplasmic reticulum histidine-... 60 4e-06 ref|XP_012831274.1| PREDICTED: uncharacterized protein DDB_G0283... 60 4e-06 >gb|EPS64483.1| hypothetical protein M569_10301, partial [Genlisea aurea] Length = 96 Score = 64.3 bits (155), Expect = 2e-07 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = +1 Query: 118 IILFVTRGRVVFMDAKKFMQLVEEKKRRVLAKKEAPLKWEQ 240 +I+ GR V MDAKKF+QLVE+KK+R+LAKKEAPLKWEQ Sbjct: 5 VIIIPNAGRFVSMDAKKFLQLVEDKKKRILAKKEAPLKWEQ 45 >ref|XP_011075949.1| PREDICTED: sarcoplasmic reticulum histidine-rich calcium-binding protein [Sesamum indicum] gi|747041964|ref|XP_011075957.1| PREDICTED: sarcoplasmic reticulum histidine-rich calcium-binding protein [Sesamum indicum] Length = 348 Score = 60.1 bits (144), Expect = 4e-06 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +1 Query: 154 MDAKKFMQLVEEKKRRVLAKKEAPLKWEQ 240 MDAKKFMQLVEEKK+RVLAKKEAPLKWEQ Sbjct: 1 MDAKKFMQLVEEKKKRVLAKKEAPLKWEQ 29 >ref|XP_012831274.1| PREDICTED: uncharacterized protein DDB_G0283697 [Erythranthe guttatus] gi|848860889|ref|XP_012831275.1| PREDICTED: uncharacterized protein DDB_G0283697 [Erythranthe guttatus] gi|604343498|gb|EYU42387.1| hypothetical protein MIMGU_mgv1a011121mg [Erythranthe guttata] Length = 292 Score = 60.1 bits (144), Expect = 4e-06 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +1 Query: 154 MDAKKFMQLVEEKKRRVLAKKEAPLKWEQ 240 MDAKKFMQLVEEKK+RVLAKKEAPLKWEQ Sbjct: 1 MDAKKFMQLVEEKKKRVLAKKEAPLKWEQ 29