BLASTX nr result
ID: Perilla23_contig00013182
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00013182 (337 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011080657.1| PREDICTED: uncharacterized protein LOC105163... 84 3e-14 ref|XP_011090068.1| PREDICTED: uncharacterized protein LOC105170... 61 2e-10 ref|XP_012841200.1| PREDICTED: uncharacterized protein LOC105961... 71 3e-10 ref|XP_012838062.1| PREDICTED: uncharacterized protein LOC105958... 67 7e-09 >ref|XP_011080657.1| PREDICTED: uncharacterized protein LOC105163859 [Sesamum indicum] Length = 852 Score = 84.3 bits (207), Expect = 3e-14 Identities = 52/105 (49%), Positives = 66/105 (62%), Gaps = 14/105 (13%) Frame = -1 Query: 331 NGSHEMLLPEKGRSQHQRRLNEKSLSP-----GNETSG----LRRIEFGSIGNLAEEVIS 179 NG HE+L P + +S+ + RL+ + SP GN+ SG RIEFGS+GNL EEVIS Sbjct: 748 NGIHEVL-PARSKSKSRGRLDVQCQSPRSVGDGNQASGDLNGSCRIEFGSVGNLGEEVIS 806 Query: 178 ASADIKGPTLGRNRTS-----VMKQERFAGKSIHLKNEAEFPPLC 59 SA + G LG + + +MKQER G SIHLKNE +FPPLC Sbjct: 807 TSAHVCGSALGVSLETQCTKKLMKQERVPGPSIHLKNEVDFPPLC 851 >ref|XP_011090068.1| PREDICTED: uncharacterized protein LOC105170843 [Sesamum indicum] Length = 824 Score = 60.8 bits (146), Expect(2) = 2e-10 Identities = 40/73 (54%), Positives = 46/73 (63%), Gaps = 9/73 (12%) Frame = -1 Query: 337 NENGSHEMLLPEKGRSQHQRRLNEKSLSPG-----NET----SGLRRIEFGSIGNLAEEV 185 +ENGSHE + P + RSQ QRR + K SP N T SG RIEFGSIGNLAEEV Sbjct: 727 SENGSHE-ICPVRSRSQGQRRSDIKCQSPRLVGGRNHTNGYLSGSCRIEFGSIGNLAEEV 785 Query: 184 ISASADIKGPTLG 146 IS S ++ TLG Sbjct: 786 ISGSNHVRASTLG 798 Score = 31.2 bits (69), Expect(2) = 2e-10 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = -2 Query: 117 KGLQGSRSTLKMKPSSPLCAS 55 KGLQGS+STL+ K S LCAS Sbjct: 801 KGLQGSQSTLRTKMSFRLCAS 821 >ref|XP_012841200.1| PREDICTED: uncharacterized protein LOC105961493 [Erythranthe guttatus] Length = 765 Score = 71.2 bits (173), Expect = 3e-10 Identities = 42/93 (45%), Positives = 60/93 (64%), Gaps = 1/93 (1%) Frame = -1 Query: 337 NENGSHEMLLPEKGRSQHQRRLNEKSLSPGNETSG-LRRIEFGSIGNLAEEVISASADIK 161 +ENG E++ + RSQ + +S++ G++ S L RIEFGSIGNLAEEVI+AS+ + Sbjct: 675 SENGVDEVVPSARRRSQESMSQSPRSVNNGDQKSRKLSRIEFGSIGNLAEEVIAASSGV- 733 Query: 160 GPTLGRNRTSVMKQERFAGKSIHLKNEAEFPPL 62 + + S K+ER + +HLKNE EFPPL Sbjct: 734 ---IASTQCSSTKKERVSVPIVHLKNEDEFPPL 763 >ref|XP_012838062.1| PREDICTED: uncharacterized protein LOC105958608 [Erythranthe guttatus] Length = 471 Score = 66.6 bits (161), Expect = 7e-09 Identities = 41/103 (39%), Positives = 55/103 (53%), Gaps = 12/103 (11%) Frame = -1 Query: 331 NGSHEMLLPEKGRSQHQRRLNEKSLSPGNETSGLR-----RIEFGSIGNLAEEVISASAD 167 NG L R Q +++ GN+++G R+EFGS+GNL + S+S+ Sbjct: 368 NGGDSNLYGNGRRFQGRKKSTHWQSPRGNQSNGYVSNRSCRVEFGSVGNLGDVCGSSSSV 427 Query: 166 IKGPTLG-------RNRTSVMKQERFAGKSIHLKNEAEFPPLC 59 GPTLG +S+ QERF +SIHLKNE EFPPLC Sbjct: 428 RAGPTLGGPTMKMHHGSSSMSMQERFGRQSIHLKNEKEFPPLC 470