BLASTX nr result
ID: Perilla23_contig00013087
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00013087 (616 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011090773.1| PREDICTED: uncharacterized protein LOC105171... 69 2e-09 ref|XP_012832377.1| PREDICTED: myb-like protein Z [Erythranthe g... 57 8e-06 >ref|XP_011090773.1| PREDICTED: uncharacterized protein LOC105171381 [Sesamum indicum] Length = 136 Score = 68.9 bits (167), Expect = 2e-09 Identities = 46/72 (63%), Positives = 51/72 (70%), Gaps = 3/72 (4%) Frame = -3 Query: 614 ESKGTGVFIPRSTSNPRRNKNVKQAR-FMASGNNKQLFQRPCDDHNSRGL--PHNNMINP 444 ESKGTGVFIPRS SNPRR KN KQ R F SG K QRP DHNSRG+ ++N I P Sbjct: 70 ESKGTGVFIPRS-SNPRR-KNAKQGRTFTGSGTYKS--QRP-SDHNSRGVITHYSNNIIP 124 Query: 443 SCDYHSFNFRRF 408 S D++SFN RRF Sbjct: 125 SHDHYSFNLRRF 136 >ref|XP_012832377.1| PREDICTED: myb-like protein Z [Erythranthe guttatus] Length = 149 Score = 57.0 bits (136), Expect = 8e-06 Identities = 37/78 (47%), Positives = 46/78 (58%), Gaps = 9/78 (11%) Frame = -3 Query: 614 ESKGTGVFIPRSTSNPRRNKNVKQARFMASGNNKQLFQRPCDDHNSRGLPHNNM------ 453 +SKGTGVFIPRS+SNPRR KQ RF NK R D +N++ + +NN+ Sbjct: 78 QSKGTGVFIPRSSSNPRRKNVNKQGRF-----NKPQISR-ADHNNTQYMGYNNINNNSNY 131 Query: 452 ---INPSCDYHSFNFRRF 408 IN S D +SFN RRF Sbjct: 132 YNNINLSHDDNSFNLRRF 149