BLASTX nr result
ID: Perilla23_contig00011901
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00011901 (376 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012853370.1| PREDICTED: carbamoyl-phosphate synthase larg... 87 4e-15 ref|XP_011074771.1| PREDICTED: carbamoyl-phosphate synthase larg... 81 3e-13 >ref|XP_012853370.1| PREDICTED: carbamoyl-phosphate synthase large chain, chloroplastic [Erythranthe guttatus] Length = 1190 Score = 87.4 bits (215), Expect = 4e-15 Identities = 40/63 (63%), Positives = 51/63 (80%) Frame = +3 Query: 183 MSQCLHNCNNVFCKFIQTNRYLPASKKPFPRFLRQSKLASEKNLSNLYLSTRPLVLNCAK 362 MS +H+C+NVFCK Q NRYLP S KPFPRF +Q+KLAS++N + + S+RPL+LNCAK Sbjct: 1 MSHSVHHCSNVFCKSFQANRYLP-SAKPFPRFFQQNKLASKRNPNTISFSSRPLILNCAK 59 Query: 363 SQN 371 SQN Sbjct: 60 SQN 62 >ref|XP_011074771.1| PREDICTED: carbamoyl-phosphate synthase large chain, chloroplastic [Sesamum indicum] gi|747056980|ref|XP_011074772.1| PREDICTED: carbamoyl-phosphate synthase large chain, chloroplastic [Sesamum indicum] Length = 1187 Score = 80.9 bits (198), Expect = 3e-13 Identities = 37/63 (58%), Positives = 49/63 (77%) Frame = +3 Query: 183 MSQCLHNCNNVFCKFIQTNRYLPASKKPFPRFLRQSKLASEKNLSNLYLSTRPLVLNCAK 362 MS +H CNN CKFIQTNRYLPA+ +PFP +Q +LAS++N +++ S+RPL+LN AK Sbjct: 1 MSHSVHQCNNALCKFIQTNRYLPAA-RPFPLHFQQRRLASKRNGKSIHYSSRPLILNSAK 59 Query: 363 SQN 371 SQN Sbjct: 60 SQN 62