BLASTX nr result
ID: Perilla23_contig00011831
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00011831 (475 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011083670.1| PREDICTED: pentatricopeptide repeat-containi... 59 2e-06 >ref|XP_011083670.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63080, mitochondrial-like [Sesamum indicum] gi|747073422|ref|XP_011083671.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63080, mitochondrial-like [Sesamum indicum] gi|747073424|ref|XP_011083672.1| PREDICTED: pentatricopeptide repeat-containing protein At1g63080, mitochondrial-like [Sesamum indicum] Length = 733 Score = 58.5 bits (140), Expect = 2e-06 Identities = 29/51 (56%), Positives = 34/51 (66%) Frame = -2 Query: 162 MNLRCFFSRHTVRNISKLNGRAFSQHSSGYRCVAGASTSTTPSFHPLGAHH 10 MNLR FF R TV ISKL+GR S +SSGYR A S+ P FHP G++H Sbjct: 1 MNLRRFFRRSTVTKISKLHGRGLSSYSSGYRFGAITSSCVPPLFHPSGSYH 51