BLASTX nr result
ID: Perilla23_contig00011762
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00011762 (326 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004233328.2| PREDICTED: high affinity nitrate transporter... 61 4e-07 ref|XP_004233327.2| PREDICTED: high affinity nitrate transporter... 61 4e-07 ref|XP_010492265.1| PREDICTED: high affinity nitrate transporter... 58 3e-06 ref|XP_010453583.1| PREDICTED: high affinity nitrate transporter... 57 4e-06 ref|XP_010420099.1| PREDICTED: high affinity nitrate transporter... 57 4e-06 ref|XP_010420098.1| PREDICTED: high affinity nitrate transporter... 57 4e-06 ref|XP_012855109.1| PREDICTED: high affinity nitrate transporter... 57 4e-06 ref|XP_002318680.2| hypothetical protein POPTR_0012s08950g [Popu... 57 4e-06 ref|XP_010100419.1| High affinity nitrate transporter 2.5 [Morus... 57 7e-06 ref|XP_011046249.1| PREDICTED: high affinity nitrate transporter... 57 7e-06 ref|XP_011040491.1| PREDICTED: high affinity nitrate transporter... 57 7e-06 ref|XP_009796050.1| PREDICTED: high affinity nitrate transporter... 56 9e-06 ref|XP_006357156.1| PREDICTED: high affinity nitrate transporter... 56 9e-06 ref|XP_006357155.1| PREDICTED: high affinity nitrate transporter... 56 9e-06 >ref|XP_004233328.2| PREDICTED: high affinity nitrate transporter 2.7 isoform X2 [Solanum lycopersicum] Length = 458 Score = 60.8 bits (146), Expect = 4e-07 Identities = 30/52 (57%), Positives = 37/52 (71%), Gaps = 6/52 (11%) Frame = -3 Query: 138 VAIAMEEQFP------SKTKTTLKLDSHHKATEFRPFSLSSPHMRAFHLSWI 1 +AIAMEE+ S ++ +D HKATEFRPFSLSSPHMRAFHL+W+ Sbjct: 39 IAIAMEEEQSHSKIDQSPNNFSIAVDYDHKATEFRPFSLSSPHMRAFHLAWL 90 >ref|XP_004233327.2| PREDICTED: high affinity nitrate transporter 2.7 isoform X1 [Solanum lycopersicum] Length = 502 Score = 60.8 bits (146), Expect = 4e-07 Identities = 30/52 (57%), Positives = 37/52 (71%), Gaps = 6/52 (11%) Frame = -3 Query: 138 VAIAMEEQFP------SKTKTTLKLDSHHKATEFRPFSLSSPHMRAFHLSWI 1 +AIAMEE+ S ++ +D HKATEFRPFSLSSPHMRAFHL+W+ Sbjct: 39 IAIAMEEEQSHSKIDQSPNNFSIAVDYDHKATEFRPFSLSSPHMRAFHLAWL 90 >ref|XP_010492265.1| PREDICTED: high affinity nitrate transporter 2.7-like [Camelina sativa] Length = 486 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = -3 Query: 126 MEEQFPSKTKTTLKLDSHHKATEFRPFSLSSPHMRAFHLSWI 1 ME PS + TT+ +DS +AT FRPFSLSSPH RAFHL+W+ Sbjct: 1 MEPSQPSLSHTTIPVDSDGRATVFRPFSLSSPHSRAFHLAWL 42 >ref|XP_010453583.1| PREDICTED: high affinity nitrate transporter 2.7 [Camelina sativa] Length = 482 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = -3 Query: 126 MEEQFPSKTKTTLKLDSHHKATEFRPFSLSSPHMRAFHLSWI 1 ME PS + TT+ +DS +AT FRPFSLSSPH RAFHL+W+ Sbjct: 1 MEPSQPSLSHTTVPVDSDGRATVFRPFSLSSPHSRAFHLAWL 42 >ref|XP_010420099.1| PREDICTED: high affinity nitrate transporter 2.7-like isoform X2 [Camelina sativa] Length = 485 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = -3 Query: 126 MEEQFPSKTKTTLKLDSHHKATEFRPFSLSSPHMRAFHLSWI 1 ME PS + TT+ +DS +AT FRPFSLSSPH RAFHL+W+ Sbjct: 1 MEPSQPSLSHTTVPVDSDGRATVFRPFSLSSPHSRAFHLAWL 42 >ref|XP_010420098.1| PREDICTED: high affinity nitrate transporter 2.7-like isoform X1 [Camelina sativa] Length = 485 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = -3 Query: 126 MEEQFPSKTKTTLKLDSHHKATEFRPFSLSSPHMRAFHLSWI 1 ME PS + TT+ +DS +AT FRPFSLSSPH RAFHL+W+ Sbjct: 1 MEPSQPSLSHTTVPVDSDGRATVFRPFSLSSPHSRAFHLAWL 42 >ref|XP_012855109.1| PREDICTED: high affinity nitrate transporter 2.7-like [Erythranthe guttatus] gi|848914443|ref|XP_012855142.1| PREDICTED: high affinity nitrate transporter 2.7-like [Erythranthe guttatus] gi|604303173|gb|EYU22672.1| hypothetical protein MIMGU_mgv1a005911mg [Erythranthe guttata] Length = 465 Score = 57.4 bits (137), Expect = 4e-06 Identities = 30/44 (68%), Positives = 35/44 (79%), Gaps = 4/44 (9%) Frame = -3 Query: 120 EQFPSKT--KTT--LKLDSHHKATEFRPFSLSSPHMRAFHLSWI 1 EQ SKT +TT L++DS HKAT FRPFS+S PHMRAFHL+WI Sbjct: 6 EQQASKTTDQTTFPLQVDSEHKATVFRPFSISPPHMRAFHLAWI 49 >ref|XP_002318680.2| hypothetical protein POPTR_0012s08950g [Populus trichocarpa] gi|550326698|gb|EEE96900.2| hypothetical protein POPTR_0012s08950g [Populus trichocarpa] Length = 384 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/45 (62%), Positives = 33/45 (73%) Frame = -3 Query: 135 AIAMEEQFPSKTKTTLKLDSHHKATEFRPFSLSSPHMRAFHLSWI 1 A E Q P K TL +DS HKATEFR FS+++PHMRAFHLSW+ Sbjct: 7 ATEKESQSP---KFTLPVDSEHKATEFRLFSVAAPHMRAFHLSWV 48 >ref|XP_010100419.1| High affinity nitrate transporter 2.5 [Morus notabilis] gi|587894021|gb|EXB82553.1| High affinity nitrate transporter 2.5 [Morus notabilis] Length = 585 Score = 56.6 bits (135), Expect = 7e-06 Identities = 24/45 (53%), Positives = 33/45 (73%) Frame = -3 Query: 135 AIAMEEQFPSKTKTTLKLDSHHKATEFRPFSLSSPHMRAFHLSWI 1 A ++++ + K L +DS HKATEFR FS++ PHMRAFHLSW+ Sbjct: 9 ATSLDQSKSNPQKFALPVDSEHKATEFRLFSIAKPHMRAFHLSWV 53 >ref|XP_011046249.1| PREDICTED: high affinity nitrate transporter 2.5-like [Populus euphratica] Length = 420 Score = 56.6 bits (135), Expect = 7e-06 Identities = 28/45 (62%), Positives = 33/45 (73%) Frame = -3 Query: 135 AIAMEEQFPSKTKTTLKLDSHHKATEFRPFSLSSPHMRAFHLSWI 1 A A E Q P K L +DS HKATEFR FS+++PHMRAFHLSW+ Sbjct: 7 ATAKESQPP---KFALPVDSEHKATEFRLFSVAAPHMRAFHLSWV 48 >ref|XP_011040491.1| PREDICTED: high affinity nitrate transporter 2.5-like [Populus euphratica] Length = 508 Score = 56.6 bits (135), Expect = 7e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -3 Query: 99 KTTLKLDSHHKATEFRPFSLSSPHMRAFHLSWI 1 K TL +DS HKATEFR FS+++PHMRAFHLSW+ Sbjct: 16 KFTLPVDSEHKATEFRLFSVAAPHMRAFHLSWV 48 >ref|XP_009796050.1| PREDICTED: high affinity nitrate transporter 2.5 [Nicotiana sylvestris] Length = 494 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = -3 Query: 126 MEEQFPSKTKTTLKLDSHHKATEFRPFSLSSPHMRAFHLSWI 1 ME + + K L +DS HKATEFR +S S+PHMR+FHLSWI Sbjct: 4 MESESNADRKFALPVDSEHKATEFRVYSASAPHMRSFHLSWI 45 >ref|XP_006357156.1| PREDICTED: high affinity nitrate transporter 2.7-like isoform X2 [Solanum tuberosum] Length = 417 Score = 56.2 bits (134), Expect = 9e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -3 Query: 93 TLKLDSHHKATEFRPFSLSSPHMRAFHLSWI 1 ++ +D HKATEFRPFSLSSPHMRAFHL+W+ Sbjct: 18 SIAVDYDHKATEFRPFSLSSPHMRAFHLAWL 48 >ref|XP_006357155.1| PREDICTED: high affinity nitrate transporter 2.7-like isoform X1 [Solanum tuberosum] Length = 463 Score = 56.2 bits (134), Expect = 9e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -3 Query: 93 TLKLDSHHKATEFRPFSLSSPHMRAFHLSWI 1 ++ +D HKATEFRPFSLSSPHMRAFHL+W+ Sbjct: 18 SIAVDYDHKATEFRPFSLSSPHMRAFHLAWL 48