BLASTX nr result
ID: Perilla23_contig00011506
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00011506 (348 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_008992361.1| hypothetical protein Salmi_Mp095 (mitochondr... 137 4e-30 >ref|YP_008992361.1| hypothetical protein Salmi_Mp095 (mitochondrion) [Salvia miltiorrhiza] gi|534292331|gb|AGU16623.1| hypothetical protein Salmi_Mp095 (mitochondrion) [Salvia miltiorrhiza] Length = 317 Score = 137 bits (344), Expect = 4e-30 Identities = 65/65 (100%), Positives = 65/65 (100%) Frame = -2 Query: 347 TEALDFIVDSIEKVGSLNQYNLSDPGSSFERRVVTTILQYWIQDIQQHGHLSPFYLQFLD 168 TEALDFIVDSIEKVGSLNQYNLSDPGSSFERRVVTTILQYWIQDIQQHGHLSPFYLQFLD Sbjct: 253 TEALDFIVDSIEKVGSLNQYNLSDPGSSFERRVVTTILQYWIQDIQQHGHLSPFYLQFLD 312 Query: 167 HFMGF 153 HFMGF Sbjct: 313 HFMGF 317