BLASTX nr result
ID: Perilla23_contig00011052
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00011052 (436 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ALA09287.1| C2C2-Zn CO-like transcription factor, partial [Gl... 68 3e-09 ref|XP_010101614.1| Salt tolerance-like protein [Morus notabilis... 68 3e-09 ref|XP_011656726.1| PREDICTED: B-box zinc finger protein 24-like... 68 3e-09 gb|KHN25299.1| Salt tolerance protein [Glycine soja] gi|94707577... 68 3e-09 gb|KFK31219.1| hypothetical protein AALP_AA6G083700 [Arabis alpina] 68 3e-09 gb|KFK31218.1| hypothetical protein AALP_AA6G083700 [Arabis alpina] 68 3e-09 ref|XP_008460039.1| PREDICTED: salt tolerance protein-like isofo... 68 3e-09 ref|XP_013456310.1| salt tolerance-like protein [Medicago trunca... 68 3e-09 ref|XP_013456309.1| salt tolerance-like protein [Medicago trunca... 68 3e-09 ref|XP_008229182.1| PREDICTED: salt tolerance protein-like [Prun... 68 3e-09 ref|XP_008222603.1| PREDICTED: salt tolerance protein-like [Prun... 68 3e-09 gb|KDO46280.1| hypothetical protein CISIN_1g026124mg [Citrus sin... 68 3e-09 gb|KDO46279.1| hypothetical protein CISIN_1g026124mg [Citrus sin... 68 3e-09 gb|KDO46278.1| hypothetical protein CISIN_1g026124mg [Citrus sin... 68 3e-09 gb|KDO46276.1| hypothetical protein CISIN_1g026124mg [Citrus sin... 68 3e-09 ref|NP_001295820.1| B-box zinc finger protein 24-like [Cucumis s... 68 3e-09 ref|NP_001237182.1| salt-tolerance protein [Glycine max] gi|7817... 68 3e-09 ref|XP_012837486.1| PREDICTED: B-box zinc finger protein 25-like... 68 3e-09 ref|XP_006442999.1| hypothetical protein CICLE_v10021980mg [Citr... 68 3e-09 ref|XP_004507341.1| PREDICTED: B-box zinc finger protein 24 [Cic... 68 3e-09 >gb|ALA09287.1| C2C2-Zn CO-like transcription factor, partial [Glycine max] Length = 238 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 90 MKIQCDVCEKAPATVICCADEAALCSKCDV 1 MKIQCDVCEKAPATVICCADEAALC+KCDV Sbjct: 1 MKIQCDVCEKAPATVICCADEAALCAKCDV 30 >ref|XP_010101614.1| Salt tolerance-like protein [Morus notabilis] gi|587900616|gb|EXB88917.1| Salt tolerance-like protein [Morus notabilis] Length = 238 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 90 MKIQCDVCEKAPATVICCADEAALCSKCDV 1 MKIQCDVCEKAPATVICCADEAALC+KCDV Sbjct: 1 MKIQCDVCEKAPATVICCADEAALCAKCDV 30 >ref|XP_011656726.1| PREDICTED: B-box zinc finger protein 24-like isoform X2 [Cucumis sativus] Length = 236 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 90 MKIQCDVCEKAPATVICCADEAALCSKCDV 1 MKIQCDVCEKAPATVICCADEAALC+KCDV Sbjct: 1 MKIQCDVCEKAPATVICCADEAALCAKCDV 30 >gb|KHN25299.1| Salt tolerance protein [Glycine soja] gi|947075777|gb|KRH24617.1| hypothetical protein GLYMA_12G051700 [Glycine max] Length = 238 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 90 MKIQCDVCEKAPATVICCADEAALCSKCDV 1 MKIQCDVCEKAPATVICCADEAALC+KCDV Sbjct: 1 MKIQCDVCEKAPATVICCADEAALCAKCDV 30 >gb|KFK31219.1| hypothetical protein AALP_AA6G083700 [Arabis alpina] Length = 241 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 90 MKIQCDVCEKAPATVICCADEAALCSKCDV 1 MKIQCDVCEKAPAT+ICCADEAALCSKCDV Sbjct: 1 MKIQCDVCEKAPATLICCADEAALCSKCDV 30 >gb|KFK31218.1| hypothetical protein AALP_AA6G083700 [Arabis alpina] Length = 242 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 90 MKIQCDVCEKAPATVICCADEAALCSKCDV 1 MKIQCDVCEKAPAT+ICCADEAALCSKCDV Sbjct: 1 MKIQCDVCEKAPATLICCADEAALCSKCDV 30 >ref|XP_008460039.1| PREDICTED: salt tolerance protein-like isoform X2 [Cucumis melo] Length = 236 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 90 MKIQCDVCEKAPATVICCADEAALCSKCDV 1 MKIQCDVCEKAPATVICCADEAALC+KCDV Sbjct: 1 MKIQCDVCEKAPATVICCADEAALCAKCDV 30 >ref|XP_013456310.1| salt tolerance-like protein [Medicago truncatula] gi|657388391|gb|KEH30341.1| salt tolerance-like protein [Medicago truncatula] Length = 240 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 90 MKIQCDVCEKAPATVICCADEAALCSKCDV 1 MKIQCDVCEKAPATVICCADEAALC+KCDV Sbjct: 1 MKIQCDVCEKAPATVICCADEAALCAKCDV 30 >ref|XP_013456309.1| salt tolerance-like protein [Medicago truncatula] gi|657388390|gb|KEH30340.1| salt tolerance-like protein [Medicago truncatula] Length = 239 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 90 MKIQCDVCEKAPATVICCADEAALCSKCDV 1 MKIQCDVCEKAPATVICCADEAALC+KCDV Sbjct: 1 MKIQCDVCEKAPATVICCADEAALCAKCDV 30 >ref|XP_008229182.1| PREDICTED: salt tolerance protein-like [Prunus mume] Length = 241 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 90 MKIQCDVCEKAPATVICCADEAALCSKCDV 1 MKIQCDVCEKAPATVICCADEAALC+KCDV Sbjct: 1 MKIQCDVCEKAPATVICCADEAALCAKCDV 30 >ref|XP_008222603.1| PREDICTED: salt tolerance protein-like [Prunus mume] Length = 238 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 90 MKIQCDVCEKAPATVICCADEAALCSKCDV 1 MKIQCDVCEKAPATVICCADEAALC+KCDV Sbjct: 1 MKIQCDVCEKAPATVICCADEAALCAKCDV 30 >gb|KDO46280.1| hypothetical protein CISIN_1g026124mg [Citrus sinensis] Length = 167 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 90 MKIQCDVCEKAPATVICCADEAALCSKCDV 1 MKIQCDVCEKAPATVICCADEAALC+KCDV Sbjct: 1 MKIQCDVCEKAPATVICCADEAALCAKCDV 30 >gb|KDO46279.1| hypothetical protein CISIN_1g026124mg [Citrus sinensis] Length = 171 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 90 MKIQCDVCEKAPATVICCADEAALCSKCDV 1 MKIQCDVCEKAPATVICCADEAALC+KCDV Sbjct: 1 MKIQCDVCEKAPATVICCADEAALCAKCDV 30 >gb|KDO46278.1| hypothetical protein CISIN_1g026124mg [Citrus sinensis] Length = 238 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 90 MKIQCDVCEKAPATVICCADEAALCSKCDV 1 MKIQCDVCEKAPATVICCADEAALC+KCDV Sbjct: 1 MKIQCDVCEKAPATVICCADEAALCAKCDV 30 >gb|KDO46276.1| hypothetical protein CISIN_1g026124mg [Citrus sinensis] gi|641827077|gb|KDO46277.1| hypothetical protein CISIN_1g026124mg [Citrus sinensis] Length = 243 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 90 MKIQCDVCEKAPATVICCADEAALCSKCDV 1 MKIQCDVCEKAPATVICCADEAALC+KCDV Sbjct: 1 MKIQCDVCEKAPATVICCADEAALCAKCDV 30 >ref|NP_001295820.1| B-box zinc finger protein 24-like [Cucumis sativus] gi|168480805|gb|ACA24496.1| putative transcription factor [Cucumis sativus] Length = 237 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 90 MKIQCDVCEKAPATVICCADEAALCSKCDV 1 MKIQCDVCEKAPATVICCADEAALC+KCDV Sbjct: 1 MKIQCDVCEKAPATVICCADEAALCAKCDV 30 >ref|NP_001237182.1| salt-tolerance protein [Glycine max] gi|78173056|gb|ABB29467.1| salt-tolerance protein [Glycine max] Length = 238 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 90 MKIQCDVCEKAPATVICCADEAALCSKCDV 1 MKIQCDVCEKAPATVICCADEAALC+KCDV Sbjct: 1 MKIQCDVCEKAPATVICCADEAALCAKCDV 30 >ref|XP_012837486.1| PREDICTED: B-box zinc finger protein 25-like [Erythranthe guttatus] gi|604332911|gb|EYU37370.1| hypothetical protein MIMGU_mgv1a012663mg [Erythranthe guttata] Length = 244 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 90 MKIQCDVCEKAPATVICCADEAALCSKCDV 1 MKIQCDVCEKAPATVICCADEAALC+KCDV Sbjct: 1 MKIQCDVCEKAPATVICCADEAALCAKCDV 30 >ref|XP_006442999.1| hypothetical protein CICLE_v10021980mg [Citrus clementina] gi|568850007|ref|XP_006478724.1| PREDICTED: salt tolerance-like protein-like isoform X1 [Citrus sinensis] gi|568850009|ref|XP_006478725.1| PREDICTED: salt tolerance-like protein-like isoform X2 [Citrus sinensis] gi|557545261|gb|ESR56239.1| hypothetical protein CICLE_v10021980mg [Citrus clementina] Length = 238 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 90 MKIQCDVCEKAPATVICCADEAALCSKCDV 1 MKIQCDVCEKAPATVICCADEAALC+KCDV Sbjct: 1 MKIQCDVCEKAPATVICCADEAALCAKCDV 30 >ref|XP_004507341.1| PREDICTED: B-box zinc finger protein 24 [Cicer arietinum] Length = 240 Score = 67.8 bits (164), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 90 MKIQCDVCEKAPATVICCADEAALCSKCDV 1 MKIQCDVCEKAPATVICCADEAALC+KCDV Sbjct: 1 MKIQCDVCEKAPATVICCADEAALCTKCDV 30