BLASTX nr result
ID: Perilla23_contig00009412
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00009412 (356 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011075959.1| PREDICTED: KH domain-containing protein At4g... 71 4e-10 >ref|XP_011075959.1| PREDICTED: KH domain-containing protein At4g18375 [Sesamum indicum] Length = 669 Score = 70.9 bits (172), Expect = 4e-10 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -3 Query: 99 MERSRSKRYYYDQDYESETLHSRSKPRYSNNSH 1 MERSRSKRYYYDQDYESETLH+RSKPRY NNSH Sbjct: 1 MERSRSKRYYYDQDYESETLHTRSKPRYGNNSH 33