BLASTX nr result
ID: Perilla23_contig00009203
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00009203 (427 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011075110.1| PREDICTED: uncharacterized protein LOC105159... 86 1e-14 ref|XP_012848858.1| PREDICTED: uncharacterized protein LOC105968... 67 4e-09 gb|EYU27645.1| hypothetical protein MIMGU_mgv1a004828mg [Erythra... 67 4e-09 ref|XP_007050704.1| Mitochondrial transcription termination fact... 62 2e-07 ref|XP_011033670.1| PREDICTED: uncharacterized protein LOC105132... 56 9e-06 ref|XP_006344266.1| PREDICTED: uncharacterized protein LOC102592... 56 9e-06 ref|XP_002321054.2| mitochondrial transcription termination fact... 56 9e-06 >ref|XP_011075110.1| PREDICTED: uncharacterized protein LOC105159670 [Sesamum indicum] gi|747057605|ref|XP_011075111.1| PREDICTED: uncharacterized protein LOC105159670 [Sesamum indicum] gi|747057607|ref|XP_011075113.1| PREDICTED: uncharacterized protein LOC105159670 [Sesamum indicum] Length = 524 Score = 85.5 bits (210), Expect = 1e-14 Identities = 39/55 (70%), Positives = 45/55 (81%) Frame = +2 Query: 260 MKITSYASLTRPSFLLFHPELPALAFHGPQLVSTSSLCISSNCMKRCGLVMKIHS 424 MK+TSY L +PSFLL H ELPA AFH Q+VS SSLC+SSNC KRCGLVMK++S Sbjct: 1 MKVTSYTGLAKPSFLLVHYELPAFAFHRSQMVSISSLCVSSNCKKRCGLVMKLYS 55 >ref|XP_012848858.1| PREDICTED: uncharacterized protein LOC105968744 [Erythranthe guttatus] Length = 524 Score = 67.4 bits (163), Expect = 4e-09 Identities = 32/56 (57%), Positives = 37/56 (66%) Frame = +2 Query: 260 MKITSYASLTRPSFLLFHPELPALAFHGPQLVSTSSLCISSNCMKRCGLVMKIHSS 427 MKI SYA + +P FLL H E PA AFH QL+S S+C S K C LVMK+HSS Sbjct: 1 MKIASYAGVAKPGFLLVHYEFPAFAFHRNQLISIPSICAPSKYKKPCSLVMKLHSS 56 >gb|EYU27645.1| hypothetical protein MIMGU_mgv1a004828mg [Erythranthe guttata] gi|604314940|gb|EYU27646.1| hypothetical protein MIMGU_mgv1a004828mg [Erythranthe guttata] Length = 508 Score = 67.4 bits (163), Expect = 4e-09 Identities = 32/56 (57%), Positives = 37/56 (66%) Frame = +2 Query: 260 MKITSYASLTRPSFLLFHPELPALAFHGPQLVSTSSLCISSNCMKRCGLVMKIHSS 427 MKI SYA + +P FLL H E PA AFH QL+S S+C S K C LVMK+HSS Sbjct: 1 MKIASYAGVAKPGFLLVHYEFPAFAFHRNQLISIPSICAPSKYKKPCSLVMKLHSS 56 >ref|XP_007050704.1| Mitochondrial transcription termination factor family protein isoform 1 [Theobroma cacao] gi|590717915|ref|XP_007050705.1| Mitochondrial transcription termination factor family protein isoform 1 [Theobroma cacao] gi|508702965|gb|EOX94861.1| Mitochondrial transcription termination factor family protein isoform 1 [Theobroma cacao] gi|508702966|gb|EOX94862.1| Mitochondrial transcription termination factor family protein isoform 1 [Theobroma cacao] Length = 523 Score = 61.6 bits (148), Expect = 2e-07 Identities = 30/56 (53%), Positives = 38/56 (67%) Frame = +2 Query: 260 MKITSYASLTRPSFLLFHPELPALAFHGPQLVSTSSLCISSNCMKRCGLVMKIHSS 427 MKI SYA +T+PSFLL H ELPAL FH P+L TS+L I N + GL+ ++ S Sbjct: 1 MKIRSYAGITKPSFLLVHSELPALTFHKPKLTWTSTLRIPRNYERNFGLIARVQCS 56 >ref|XP_011033670.1| PREDICTED: uncharacterized protein LOC105132081 [Populus euphratica] gi|743870779|ref|XP_011033671.1| PREDICTED: uncharacterized protein LOC105132081 [Populus euphratica] gi|743870783|ref|XP_011033672.1| PREDICTED: uncharacterized protein LOC105132081 [Populus euphratica] Length = 521 Score = 56.2 bits (134), Expect = 9e-06 Identities = 30/49 (61%), Positives = 34/49 (69%) Frame = +2 Query: 260 MKITSYASLTRPSFLLFHPELPALAFHGPQLVSTSSLCISSNCMKRCGL 406 M I SYA +TRPSFLL HPELP L + QL S S+L I SN MKR G+ Sbjct: 1 MTIVSYAGITRPSFLLAHPELPVLVYCKLQLNSISTLRIPSNDMKRTGV 49 >ref|XP_006344266.1| PREDICTED: uncharacterized protein LOC102592200 [Solanum tuberosum] Length = 540 Score = 56.2 bits (134), Expect = 9e-06 Identities = 31/71 (43%), Positives = 45/71 (63%), Gaps = 3/71 (4%) Frame = +2 Query: 215 KICSPFLLFAE---YIQGMKITSYASLTRPSFLLFHPELPALAFHGPQLVSTSSLCISSN 385 K C F + E ++Q MK+ SY + PSFLL + ELP+ FH P+L+STS+ ISS Sbjct: 3 KRCLLFHIHTERGFHLQNMKVISYNRIINPSFLLINHELPSNTFHRPRLISTSAPSISSF 62 Query: 386 CMKRCGLVMKI 418 MK+ L+M++ Sbjct: 63 NMKKKDLMMRL 73 >ref|XP_002321054.2| mitochondrial transcription termination factor family protein [Populus trichocarpa] gi|550324117|gb|EEE99369.2| mitochondrial transcription termination factor family protein [Populus trichocarpa] Length = 521 Score = 56.2 bits (134), Expect = 9e-06 Identities = 30/46 (65%), Positives = 33/46 (71%) Frame = +2 Query: 260 MKITSYASLTRPSFLLFHPELPALAFHGPQLVSTSSLCISSNCMKR 397 M I SYA +TRPSFLL HPELP L + QL STS+L I SN MKR Sbjct: 1 MTIVSYAGITRPSFLLAHPELPVLVYCKLQLNSTSALRIPSNDMKR 46