BLASTX nr result
ID: Perilla23_contig00008211
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00008211 (364 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KNA18115.1| hypothetical protein SOVF_073810 isoform B [Spina... 72 1e-10 gb|KNA18114.1| hypothetical protein SOVF_073810 isoform A [Spina... 72 1e-10 ref|XP_012574237.1| PREDICTED: SURP and G-patch domain-containin... 72 1e-10 ref|XP_011093535.1| PREDICTED: SURP and G-patch domain-containin... 72 1e-10 ref|XP_011093534.1| PREDICTED: SURP and G-patch domain-containin... 72 1e-10 ref|XP_010238005.1| PREDICTED: SURP and G-patch domain-containin... 72 1e-10 ref|XP_013445038.1| suppressor-of-white-APricot splicing regulat... 72 1e-10 ref|XP_003627716.2| suppressor-of-white-APricot splicing regulat... 72 1e-10 ref|XP_013445035.1| SURP and G-patch domain protein [Medicago tr... 72 1e-10 ref|XP_012574238.1| PREDICTED: SURP and G-patch domain-containin... 72 1e-10 ref|XP_004510975.1| PREDICTED: SURP and G-patch domain-containin... 72 1e-10 ref|XP_004306515.1| PREDICTED: SURP and G-patch domain-containin... 72 1e-10 ref|XP_003577922.1| PREDICTED: SURP and G-patch domain-containin... 72 1e-10 ref|XP_011007347.1| PREDICTED: SURP and G-patch domain-containin... 71 3e-10 ref|XP_011007345.1| PREDICTED: SURP and G-patch domain-containin... 71 3e-10 ref|XP_011025054.1| PREDICTED: SURP and G-patch domain-containin... 71 3e-10 ref|XP_002298445.1| hypothetical protein POPTR_0001s27670g [Popu... 71 3e-10 ref|XP_006369640.1| hypothetical protein POPTR_0001s27670g [Popu... 71 3e-10 ref|XP_006379104.1| hypothetical protein POPTR_0009s06900g [Popu... 71 3e-10 dbj|BAJ86077.1| predicted protein [Hordeum vulgare subsp. vulgare] 70 5e-10 >gb|KNA18115.1| hypothetical protein SOVF_073810 isoform B [Spinacia oleracea] Length = 430 Score = 72.4 bits (176), Expect = 1e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 364 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY 272 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY Sbjct: 400 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY 430 >gb|KNA18114.1| hypothetical protein SOVF_073810 isoform A [Spinacia oleracea] Length = 431 Score = 72.4 bits (176), Expect = 1e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 364 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY 272 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY Sbjct: 401 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY 431 >ref|XP_012574237.1| PREDICTED: SURP and G-patch domain-containing protein 1-like protein isoform X2 [Cicer arietinum] Length = 433 Score = 72.4 bits (176), Expect = 1e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 364 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY 272 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY Sbjct: 403 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY 433 >ref|XP_011093535.1| PREDICTED: SURP and G-patch domain-containing protein 1-like protein isoform X2 [Sesamum indicum] Length = 355 Score = 72.4 bits (176), Expect = 1e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 364 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY 272 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY Sbjct: 325 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY 355 >ref|XP_011093534.1| PREDICTED: SURP and G-patch domain-containing protein 1-like protein isoform X1 [Sesamum indicum] Length = 433 Score = 72.4 bits (176), Expect = 1e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 364 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY 272 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY Sbjct: 403 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY 433 >ref|XP_010238005.1| PREDICTED: SURP and G-patch domain-containing protein 1-like protein isoform X1 [Brachypodium distachyon] gi|721678995|ref|XP_010238006.1| PREDICTED: SURP and G-patch domain-containing protein 1-like protein isoform X1 [Brachypodium distachyon] gi|721678999|ref|XP_010238007.1| PREDICTED: SURP and G-patch domain-containing protein 1-like protein isoform X1 [Brachypodium distachyon] Length = 450 Score = 72.4 bits (176), Expect = 1e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 364 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY 272 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY Sbjct: 420 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY 450 >ref|XP_013445038.1| suppressor-of-white-APricot splicing regulator [Medicago truncatula] gi|657373326|gb|KEH19063.1| suppressor-of-white-APricot splicing regulator [Medicago truncatula] Length = 438 Score = 72.4 bits (176), Expect = 1e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 364 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY 272 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY Sbjct: 408 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY 438 >ref|XP_003627716.2| suppressor-of-white-APricot splicing regulator [Medicago truncatula] gi|657373325|gb|AET02192.2| suppressor-of-white-APricot splicing regulator [Medicago truncatula] Length = 439 Score = 72.4 bits (176), Expect = 1e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 364 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY 272 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY Sbjct: 409 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY 439 >ref|XP_013445035.1| SURP and G-patch domain protein [Medicago truncatula] gi|657373322|gb|KEH19060.1| SURP and G-patch domain protein [Medicago truncatula] Length = 73 Score = 72.4 bits (176), Expect = 1e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 364 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY 272 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY Sbjct: 43 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY 73 >ref|XP_012574238.1| PREDICTED: SURP and G-patch domain-containing protein 1-like protein isoform X3 [Cicer arietinum] Length = 430 Score = 72.4 bits (176), Expect = 1e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 364 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY 272 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY Sbjct: 400 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY 430 >ref|XP_004510975.1| PREDICTED: SURP and G-patch domain-containing protein 1-like protein isoform X1 [Cicer arietinum] gi|828329392|ref|XP_012574235.1| PREDICTED: SURP and G-patch domain-containing protein 1-like protein isoform X1 [Cicer arietinum] gi|828329395|ref|XP_012574236.1| PREDICTED: SURP and G-patch domain-containing protein 1-like protein isoform X1 [Cicer arietinum] Length = 434 Score = 72.4 bits (176), Expect = 1e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 364 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY 272 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY Sbjct: 404 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY 434 >ref|XP_004306515.1| PREDICTED: SURP and G-patch domain-containing protein 1-like protein [Fragaria vesca subsp. vesca] Length = 430 Score = 72.4 bits (176), Expect = 1e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 364 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY 272 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY Sbjct: 400 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY 430 >ref|XP_003577922.1| PREDICTED: SURP and G-patch domain-containing protein 1-like protein isoform X2 [Brachypodium distachyon] gi|721679004|ref|XP_010238008.1| PREDICTED: SURP and G-patch domain-containing protein 1-like protein isoform X2 [Brachypodium distachyon] gi|944054037|gb|KQJ89675.1| hypothetical protein BRADI_4g27117 [Brachypodium distachyon] gi|944054038|gb|KQJ89676.1| hypothetical protein BRADI_4g27117 [Brachypodium distachyon] gi|944054039|gb|KQJ89677.1| hypothetical protein BRADI_4g27117 [Brachypodium distachyon] gi|944054040|gb|KQJ89678.1| hypothetical protein BRADI_4g27117 [Brachypodium distachyon] gi|944054041|gb|KQJ89679.1| hypothetical protein BRADI_4g27117 [Brachypodium distachyon] Length = 420 Score = 72.4 bits (176), Expect = 1e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 364 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY 272 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY Sbjct: 390 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY 420 >ref|XP_011007347.1| PREDICTED: SURP and G-patch domain-containing protein 1-like protein isoform X2 [Populus euphratica] Length = 440 Score = 71.2 bits (173), Expect = 3e-10 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 364 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY 272 +DDIYEQYKKRMMLGYRHRPNPLNNPRKAYY Sbjct: 410 DDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY 440 >ref|XP_011007345.1| PREDICTED: SURP and G-patch domain-containing protein 1-like protein isoform X1 [Populus euphratica] gi|743926369|ref|XP_011007346.1| PREDICTED: SURP and G-patch domain-containing protein 1-like protein isoform X1 [Populus euphratica] Length = 441 Score = 71.2 bits (173), Expect = 3e-10 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 364 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY 272 +DDIYEQYKKRMMLGYRHRPNPLNNPRKAYY Sbjct: 411 DDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY 441 >ref|XP_011025054.1| PREDICTED: SURP and G-patch domain-containing protein 1-like protein [Populus euphratica] gi|743835597|ref|XP_011025055.1| PREDICTED: SURP and G-patch domain-containing protein 1-like protein [Populus euphratica] gi|743835601|ref|XP_011025056.1| PREDICTED: SURP and G-patch domain-containing protein 1-like protein [Populus euphratica] gi|743835605|ref|XP_011025057.1| PREDICTED: SURP and G-patch domain-containing protein 1-like protein [Populus euphratica] gi|743835611|ref|XP_011025058.1| PREDICTED: SURP and G-patch domain-containing protein 1-like protein [Populus euphratica] Length = 440 Score = 71.2 bits (173), Expect = 3e-10 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 364 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY 272 +DDIYEQYKKRMMLGYRHRPNPLNNPRKAYY Sbjct: 410 DDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY 440 >ref|XP_002298445.1| hypothetical protein POPTR_0001s27670g [Populus trichocarpa] gi|566151339|ref|XP_006369641.1| SWAP/surp domain-containing family protein [Populus trichocarpa] gi|222845703|gb|EEE83250.1| hypothetical protein POPTR_0001s27670g [Populus trichocarpa] gi|550348330|gb|ERP66210.1| SWAP/surp domain-containing family protein [Populus trichocarpa] Length = 450 Score = 71.2 bits (173), Expect = 3e-10 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 364 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY 272 +DDIYEQYKKRMMLGYRHRPNPLNNPRKAYY Sbjct: 420 DDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY 450 >ref|XP_006369640.1| hypothetical protein POPTR_0001s27670g [Populus trichocarpa] gi|550348329|gb|ERP66209.1| hypothetical protein POPTR_0001s27670g [Populus trichocarpa] Length = 440 Score = 71.2 bits (173), Expect = 3e-10 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 364 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY 272 +DDIYEQYKKRMMLGYRHRPNPLNNPRKAYY Sbjct: 410 DDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY 440 >ref|XP_006379104.1| hypothetical protein POPTR_0009s06900g [Populus trichocarpa] gi|550331203|gb|ERP56901.1| hypothetical protein POPTR_0009s06900g [Populus trichocarpa] Length = 378 Score = 71.2 bits (173), Expect = 3e-10 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 364 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY 272 +DDIYEQYKKRMMLGYRHRPNPLNNPRKAYY Sbjct: 348 DDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY 378 >dbj|BAJ86077.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 431 Score = 70.5 bits (171), Expect = 5e-10 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 364 EDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY 272 EDDIYEQYKKRMMLGYRHRPNPLNNPRK YY Sbjct: 401 EDDIYEQYKKRMMLGYRHRPNPLNNPRKQYY 431