BLASTX nr result
ID: Perilla23_contig00007792
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00007792 (350 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH57542.1| hypothetical protein GLYMA_05G067400 [Glycine max] 85 2e-14 gb|KOM32511.1| hypothetical protein LR48_Vigan01g206700 [Vigna a... 85 2e-14 ref|XP_010110542.1| hypothetical protein L484_023376 [Morus nota... 85 2e-14 ref|XP_010089763.1| 60S ribosomal protein L37a [Morus notabilis]... 85 2e-14 ref|XP_012075387.1| PREDICTED: 60S ribosomal protein L37a isofor... 85 2e-14 gb|KJB51747.1| hypothetical protein B456_008G230300 [Gossypium r... 85 2e-14 ref|XP_012475788.1| PREDICTED: 60S ribosomal protein L37a isofor... 85 2e-14 ref|XP_011085665.1| PREDICTED: 60S ribosomal protein L37a [Sesam... 85 2e-14 ref|XP_010692007.1| PREDICTED: 60S ribosomal protein L37a [Beta ... 85 2e-14 ref|XP_009405728.1| PREDICTED: 60S ribosomal protein L37a isofor... 85 2e-14 ref|XP_008786203.1| PREDICTED: 60S ribosomal protein L37a [Phoen... 85 2e-14 emb|CDP09397.1| unnamed protein product [Coffea canephora] 85 2e-14 emb|CDP13435.1| unnamed protein product [Coffea canephora] 85 2e-14 ref|XP_013442369.1| 60S ribosomal protein L37a-2 [Medicago trunc... 85 2e-14 gb|KDP45992.1| hypothetical protein JCGZ_11895 [Jatropha curcas] 85 2e-14 gb|KDO85434.1| hypothetical protein CISIN_1g045338mg [Citrus sin... 85 2e-14 gb|KDO57018.1| hypothetical protein CISIN_1g044880mg, partial [C... 85 2e-14 emb|CBI33982.3| unnamed protein product [Vitis vinifera] 85 2e-14 ref|XP_002282974.1| PREDICTED: 60S ribosomal protein L37a [Vitis... 85 2e-14 ref|XP_002517507.1| 60S ribosomal protein L37a, putative [Ricinu... 85 2e-14 >gb|KRH57542.1| hypothetical protein GLYMA_05G067400 [Glycine max] Length = 72 Score = 85.1 bits (209), Expect = 2e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -1 Query: 350 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 231 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 33 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 72 >gb|KOM32511.1| hypothetical protein LR48_Vigan01g206700 [Vigna angularis] Length = 126 Score = 85.1 bits (209), Expect = 2e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -1 Query: 350 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 231 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 87 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 126 >ref|XP_010110542.1| hypothetical protein L484_023376 [Morus notabilis] gi|587940139|gb|EXC26760.1| hypothetical protein L484_023376 [Morus notabilis] Length = 644 Score = 85.1 bits (209), Expect = 2e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -1 Query: 350 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 231 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 605 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 644 >ref|XP_010089763.1| 60S ribosomal protein L37a [Morus notabilis] gi|587848061|gb|EXB38355.1| 60S ribosomal protein L37a [Morus notabilis] Length = 139 Score = 85.1 bits (209), Expect = 2e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -1 Query: 350 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 231 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 100 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 139 >ref|XP_012075387.1| PREDICTED: 60S ribosomal protein L37a isoform X1 [Jatropha curcas] gi|802700509|ref|XP_012083738.1| PREDICTED: 60S ribosomal protein L37a isoform X1 [Jatropha curcas] Length = 93 Score = 85.1 bits (209), Expect = 2e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -1 Query: 350 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 231 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 54 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 93 >gb|KJB51747.1| hypothetical protein B456_008G230300 [Gossypium raimondii] Length = 96 Score = 85.1 bits (209), Expect = 2e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -1 Query: 350 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 231 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 57 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 96 >ref|XP_012475788.1| PREDICTED: 60S ribosomal protein L37a isoform X1 [Gossypium raimondii] gi|763758077|gb|KJB25408.1| hypothetical protein B456_004G190800 [Gossypium raimondii] Length = 115 Score = 85.1 bits (209), Expect = 2e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -1 Query: 350 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 231 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 76 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 115 >ref|XP_011085665.1| PREDICTED: 60S ribosomal protein L37a [Sesamum indicum] gi|747091529|ref|XP_011093498.1| PREDICTED: 60S ribosomal protein L37a [Sesamum indicum] gi|848861275|ref|XP_012831458.1| PREDICTED: 60S ribosomal protein L37a isoform X1 [Erythranthe guttatus] gi|848861277|ref|XP_012831459.1| PREDICTED: 60S ribosomal protein L37a isoform X2 [Erythranthe guttatus] Length = 92 Score = 85.1 bits (209), Expect = 2e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -1 Query: 350 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 231 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 53 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 92 >ref|XP_010692007.1| PREDICTED: 60S ribosomal protein L37a [Beta vulgaris subsp. vulgaris] gi|870847546|gb|KMS99893.1| hypothetical protein BVRB_1g017410 [Beta vulgaris subsp. vulgaris] Length = 92 Score = 85.1 bits (209), Expect = 2e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -1 Query: 350 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 231 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 53 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 92 >ref|XP_009405728.1| PREDICTED: 60S ribosomal protein L37a isoform X1 [Musa acuminata subsp. malaccensis] Length = 93 Score = 85.1 bits (209), Expect = 2e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -1 Query: 350 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 231 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 54 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 93 >ref|XP_008786203.1| PREDICTED: 60S ribosomal protein L37a [Phoenix dactylifera] gi|695011622|ref|XP_009392534.1| PREDICTED: 60S ribosomal protein L37a [Musa acuminata subsp. malaccensis] gi|695036538|ref|XP_009405729.1| PREDICTED: 60S ribosomal protein L37a isoform X2 [Musa acuminata subsp. malaccensis] gi|743827292|ref|XP_010933552.1| PREDICTED: 60S ribosomal protein L37a [Elaeis guineensis] gi|743854686|ref|XP_010941014.1| PREDICTED: 60S ribosomal protein L37a [Elaeis guineensis] Length = 92 Score = 85.1 bits (209), Expect = 2e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -1 Query: 350 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 231 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 53 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 92 >emb|CDP09397.1| unnamed protein product [Coffea canephora] Length = 160 Score = 85.1 bits (209), Expect = 2e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -1 Query: 350 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 231 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 121 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 160 >emb|CDP13435.1| unnamed protein product [Coffea canephora] Length = 146 Score = 85.1 bits (209), Expect = 2e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -1 Query: 350 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 231 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 107 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 146 >ref|XP_013442369.1| 60S ribosomal protein L37a-2 [Medicago truncatula] gi|657370216|gb|KEH16394.1| 60S ribosomal protein L37a-2 [Medicago truncatula] Length = 173 Score = 85.1 bits (209), Expect = 2e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -1 Query: 350 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 231 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 134 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 173 >gb|KDP45992.1| hypothetical protein JCGZ_11895 [Jatropha curcas] Length = 124 Score = 85.1 bits (209), Expect = 2e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -1 Query: 350 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 231 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 85 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 124 >gb|KDO85434.1| hypothetical protein CISIN_1g045338mg [Citrus sinensis] Length = 134 Score = 85.1 bits (209), Expect = 2e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -1 Query: 350 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 231 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 95 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 134 >gb|KDO57018.1| hypothetical protein CISIN_1g044880mg, partial [Citrus sinensis] Length = 91 Score = 85.1 bits (209), Expect = 2e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -1 Query: 350 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 231 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 52 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 91 >emb|CBI33982.3| unnamed protein product [Vitis vinifera] Length = 99 Score = 85.1 bits (209), Expect = 2e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -1 Query: 350 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 231 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 60 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 99 >ref|XP_002282974.1| PREDICTED: 60S ribosomal protein L37a [Vitis vinifera] gi|449432368|ref|XP_004133971.1| PREDICTED: 60S ribosomal protein L37a [Cucumis sativus] gi|449461277|ref|XP_004148368.1| PREDICTED: 60S ribosomal protein L37a [Cucumis sativus] gi|460397999|ref|XP_004244552.1| PREDICTED: 60S ribosomal protein L37a [Solanum lycopersicum] gi|460400630|ref|XP_004245836.1| PREDICTED: 60S ribosomal protein L37a [Solanum lycopersicum] gi|460400632|ref|XP_004245837.1| PREDICTED: 60S ribosomal protein L37a [Solanum lycopersicum] gi|460407079|ref|XP_004248984.1| PREDICTED: 60S ribosomal protein L37a [Solanum lycopersicum] gi|565357026|ref|XP_006345354.1| PREDICTED: 60S ribosomal protein L37a-like [Solanum tuberosum] gi|565393647|ref|XP_006362483.1| PREDICTED: 60S ribosomal protein L37a-like [Solanum tuberosum] gi|567895310|ref|XP_006440143.1| hypothetical protein CICLE_v10023068mg [Citrus clementina] gi|567905956|ref|XP_006445466.1| hypothetical protein CICLE_v10022898mg [Citrus clementina] gi|568819713|ref|XP_006464390.1| PREDICTED: 60S ribosomal protein L37a-like [Citrus sinensis] gi|568846442|ref|XP_006477063.1| PREDICTED: 60S ribosomal protein L37a-like [Citrus sinensis] gi|590676098|ref|XP_007039638.1| Zinc-binding ribosomal protein family protein [Theobroma cacao] gi|590724193|ref|XP_007052397.1| Zinc-binding ribosomal protein family protein [Theobroma cacao] gi|596012174|ref|XP_007218651.1| hypothetical protein PRUPE_ppa013989mg [Prunus persica] gi|645246729|ref|XP_008229490.1| PREDICTED: 60S ribosomal protein L37a [Prunus mume] gi|645252902|ref|XP_008232335.1| PREDICTED: 60S ribosomal protein L37a [Prunus mume] gi|657964010|ref|XP_008373627.1| PREDICTED: 60S ribosomal protein L37a [Malus domestica] gi|657980522|ref|XP_008382254.1| PREDICTED: 60S ribosomal protein L37a [Malus domestica] gi|657993644|ref|XP_008389115.1| PREDICTED: 60S ribosomal protein L37a [Malus domestica] gi|658039915|ref|XP_008355544.1| PREDICTED: 60S ribosomal protein L37a [Malus domestica] gi|659075733|ref|XP_008438301.1| PREDICTED: 60S ribosomal protein L37a [Cucumis melo] gi|659114650|ref|XP_008457163.1| PREDICTED: 60S ribosomal protein L37a [Cucumis melo] gi|659131887|ref|XP_008465908.1| PREDICTED: 60S ribosomal protein L37a [Cucumis melo] gi|694392783|ref|XP_009371855.1| PREDICTED: 60S ribosomal protein L37a [Pyrus x bretschneideri] gi|694400596|ref|XP_009375382.1| PREDICTED: 60S ribosomal protein L37a [Pyrus x bretschneideri] gi|694407272|ref|XP_009378386.1| PREDICTED: 60S ribosomal protein L37a [Pyrus x bretschneideri] gi|697106482|ref|XP_009607073.1| PREDICTED: 60S ribosomal protein L37a [Nicotiana tomentosiformis] gi|697169359|ref|XP_009593570.1| PREDICTED: 60S ribosomal protein L37a [Nicotiana tomentosiformis] gi|697177754|ref|XP_009597850.1| PREDICTED: 60S ribosomal protein L37a [Nicotiana tomentosiformis] gi|697183893|ref|XP_009600968.1| PREDICTED: 60S ribosomal protein L37a [Nicotiana tomentosiformis] gi|697185803|ref|XP_009601940.1| PREDICTED: 60S ribosomal protein L37a [Nicotiana tomentosiformis] gi|698489188|ref|XP_009791162.1| PREDICTED: 60S ribosomal protein L37a [Nicotiana sylvestris] gi|698492345|ref|XP_009792526.1| PREDICTED: 60S ribosomal protein L37a [Nicotiana sylvestris] gi|698500829|ref|XP_009796147.1| PREDICTED: 60S ribosomal protein L37a [Nicotiana sylvestris] gi|698501938|ref|XP_009796644.1| PREDICTED: 60S ribosomal protein L37a [Nicotiana sylvestris] gi|698503069|ref|XP_009797153.1| PREDICTED: 60S ribosomal protein L37a [Nicotiana sylvestris] gi|778668269|ref|XP_011649070.1| PREDICTED: 60S ribosomal protein L37a [Cucumis sativus] gi|802540250|ref|XP_012075395.1| PREDICTED: 60S ribosomal protein L37a isoform X2 [Jatropha curcas] gi|802700512|ref|XP_012083739.1| PREDICTED: 60S ribosomal protein L37a isoform X2 [Jatropha curcas] gi|823151099|ref|XP_012475378.1| PREDICTED: 60S ribosomal protein L37a [Gossypium raimondii] gi|823151917|ref|XP_012475789.1| PREDICTED: 60S ribosomal protein L37a isoform X2 [Gossypium raimondii] gi|823177404|ref|XP_012486779.1| PREDICTED: 60S ribosomal protein L37a [Gossypium raimondii] gi|823213325|ref|XP_012439403.1| PREDICTED: 60S ribosomal protein L37a [Gossypium raimondii] gi|823213327|ref|XP_012439404.1| PREDICTED: 60S ribosomal protein L37a [Gossypium raimondii] gi|462415113|gb|EMJ19850.1| hypothetical protein PRUPE_ppa013989mg [Prunus persica] gi|508704658|gb|EOX96554.1| Zinc-binding ribosomal protein family protein [Theobroma cacao] gi|508776883|gb|EOY24139.1| Zinc-binding ribosomal protein family protein [Theobroma cacao] gi|557542405|gb|ESR53383.1| hypothetical protein CICLE_v10023068mg [Citrus clementina] gi|557547728|gb|ESR58706.1| hypothetical protein CICLE_v10022898mg [Citrus clementina] gi|643717266|gb|KDP28892.1| hypothetical protein JCGZ_14663 [Jatropha curcas] gi|700201564|gb|KGN56697.1| hypothetical protein Csa_3G129540 [Cucumis sativus] gi|700205319|gb|KGN60452.1| hypothetical protein Csa_3G912355 [Cucumis sativus] gi|700206305|gb|KGN61424.1| hypothetical protein Csa_2G120410 [Cucumis sativus] gi|728831190|gb|KHG10633.1| 60S ribosomal L37a [Gossypium arboreum] gi|763757579|gb|KJB24910.1| hypothetical protein B456_004G167500 [Gossypium raimondii] gi|763758076|gb|KJB25407.1| hypothetical protein B456_004G190800 [Gossypium raimondii] gi|763770451|gb|KJB37666.1| hypothetical protein B456_006G214900 [Gossypium raimondii] gi|763784674|gb|KJB51745.1| hypothetical protein B456_008G230300 [Gossypium raimondii] gi|763784675|gb|KJB51746.1| hypothetical protein B456_008G230300 [Gossypium raimondii] Length = 92 Score = 85.1 bits (209), Expect = 2e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -1 Query: 350 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 231 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 53 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 92 >ref|XP_002517507.1| 60S ribosomal protein L37a, putative [Ricinus communis] gi|223543518|gb|EEF45049.1| 60S ribosomal protein L37a, putative [Ricinus communis] Length = 110 Score = 85.1 bits (209), Expect = 2e-14 Identities = 40/40 (100%), Positives = 40/40 (100%) Frame = -1 Query: 350 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 231 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES Sbjct: 71 GIWGCKDCGKVKAGGAYTLNTASAVTVRSTIRRLREQTES 110