BLASTX nr result
ID: Perilla23_contig00007507
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00007507 (537 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007214488.1| hypothetical protein PRUPE_ppa020338mg [Prun... 63 8e-08 ref|XP_007225084.1| hypothetical protein PRUPE_ppa017579mg [Prun... 59 1e-06 >ref|XP_007214488.1| hypothetical protein PRUPE_ppa020338mg [Prunus persica] gi|462410353|gb|EMJ15687.1| hypothetical protein PRUPE_ppa020338mg [Prunus persica] Length = 707 Score = 63.2 bits (152), Expect = 8e-08 Identities = 31/66 (46%), Positives = 41/66 (62%), Gaps = 2/66 (3%) Frame = -3 Query: 196 KSPYWEHCEKKTKKVNDGSLRQIGICNYRKCEIPT--VNGSTSGLKNHIVKRYKNSPLYE 23 KS W HC K+ KK +G + +G+CNY K E+P T+GLKNHI +R K SPLY+ Sbjct: 47 KSIVWLHCTKQIKKDGNGVEKVVGVCNYCKLEMPADPRKNGTTGLKNHIERRCKLSPLYQ 106 Query: 22 VSDAEK 5 DA + Sbjct: 107 QGDANQ 112 >ref|XP_007225084.1| hypothetical protein PRUPE_ppa017579mg [Prunus persica] gi|462422020|gb|EMJ26283.1| hypothetical protein PRUPE_ppa017579mg [Prunus persica] Length = 629 Score = 59.3 bits (142), Expect = 1e-06 Identities = 30/66 (45%), Positives = 40/66 (60%), Gaps = 2/66 (3%) Frame = -3 Query: 196 KSPYWEHCEKKTKKVNDGSLRQIGICNYRKCEIPT--VNGSTSGLKNHIVKRYKNSPLYE 23 KS W +C K+ KK +G + +G+CNY K E+P T+GLKNHI +R K SPLY Sbjct: 47 KSIVWLNCTKQIKKDGNGVEKVVGVCNYCKLEMPADPRKNGTTGLKNHIERRCKLSPLYP 106 Query: 22 VSDAEK 5 DA + Sbjct: 107 QGDANQ 112