BLASTX nr result
ID: Perilla23_contig00006942
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00006942 (524 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011097611.1| PREDICTED: glutamic acid-rich protein-like [... 71 4e-10 >ref|XP_011097611.1| PREDICTED: glutamic acid-rich protein-like [Sesamum indicum] gi|747099139|ref|XP_011097612.1| PREDICTED: glutamic acid-rich protein-like [Sesamum indicum] gi|747099141|ref|XP_011097613.1| PREDICTED: glutamic acid-rich protein-like [Sesamum indicum] Length = 179 Score = 70.9 bits (172), Expect = 4e-10 Identities = 36/67 (53%), Positives = 43/67 (64%) Frame = -3 Query: 387 MEINCGSVKLTTVQQSLLMCAGGETXXXXXXXXXXXXXXXAISLLSQEYMKLLTNQPNLR 208 ME NCGSV LTT++Q LLMCAG E +++L+QEY+KLLTNQP LR Sbjct: 1 MENNCGSVNLTTIKQRLLMCAGAEAALAALLVSALVKAQ--LAVLNQEYIKLLTNQPKLR 58 Query: 207 GDQHISC 187 GD H SC Sbjct: 59 GDHHTSC 65