BLASTX nr result
ID: Perilla23_contig00006708
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00006708 (458 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU29679.1| hypothetical protein MIMGU_mgv1a017470mg [Erythra... 64 3e-08 >gb|EYU29679.1| hypothetical protein MIMGU_mgv1a017470mg [Erythranthe guttata] Length = 72 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/57 (52%), Positives = 38/57 (66%) Frame = -3 Query: 426 MKIWAVLFVASLLMVGSTNEVNAELVMSKNRKLFSDLVDRVSPGGPTPCYHCIGDSK 256 MK W VLFVASLL+VGS + + ++ R L ++ V+R PGGP CYHC GDSK Sbjct: 1 MKTWVVLFVASLLIVGSIGRTDPKFANTEKRMLRNNEVNRNVPGGPNICYHCFGDSK 57