BLASTX nr result
ID: Perilla23_contig00004745
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Perilla23_contig00004745 (676 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011081074.1| PREDICTED: plastidic ATP/ADP-transporter [Se... 92 3e-16 ref|XP_012852750.1| PREDICTED: plastidic ATP/ADP-transporter [Er... 76 2e-11 ref|XP_011072264.1| PREDICTED: plastidic ATP/ADP-transporter-lik... 74 8e-11 ref|XP_012856295.1| PREDICTED: plastidic ATP/ADP-transporter-lik... 62 2e-07 emb|CDO98099.1| unnamed protein product [Coffea canephora] 62 3e-07 ref|XP_009624271.1| PREDICTED: plastidic ATP/ADP-transporter-lik... 60 1e-06 ref|XP_009758418.1| PREDICTED: plastidic ATP/ADP-transporter-lik... 58 5e-06 >ref|XP_011081074.1| PREDICTED: plastidic ATP/ADP-transporter [Sesamum indicum] Length = 630 Score = 92.0 bits (227), Expect = 3e-16 Identities = 44/54 (81%), Positives = 49/54 (90%) Frame = -2 Query: 168 MQAVLQSKGLLSLPSNPKTRAFITQPSCDLRYRFNPINPLSKSRTLNKASLSLS 7 MQ VLQSKGLLSLPSNP+TRAF+ QPSCDLRYRFNPINP KSRTLN +SL+L+ Sbjct: 1 MQGVLQSKGLLSLPSNPRTRAFLAQPSCDLRYRFNPINPPLKSRTLNGSSLTLN 54 >ref|XP_012852750.1| PREDICTED: plastidic ATP/ADP-transporter [Erythranthe guttatus] gi|604305530|gb|EYU24674.1| hypothetical protein MIMGU_mgv1a002918mg [Erythranthe guttata] Length = 625 Score = 76.3 bits (186), Expect = 2e-11 Identities = 40/48 (83%), Positives = 42/48 (87%), Gaps = 1/48 (2%) Frame = -2 Query: 168 MQAVLQSKGLLSLPSNPK-TRAFITQPSCDLRYRFNPINPLSKSRTLN 28 MQAVLQSKGLLSLPS P+ TRAFITQPS DLR RFNP NP+ KSRTLN Sbjct: 1 MQAVLQSKGLLSLPSIPRRTRAFITQPSSDLRCRFNPTNPIPKSRTLN 48 >ref|XP_011072264.1| PREDICTED: plastidic ATP/ADP-transporter-like [Sesamum indicum] Length = 626 Score = 73.9 bits (180), Expect = 8e-11 Identities = 38/54 (70%), Positives = 42/54 (77%) Frame = -2 Query: 168 MQAVLQSKGLLSLPSNPKTRAFITQPSCDLRYRFNPINPLSKSRTLNKASLSLS 7 MQ VLQSKGLLSLPSNP+TRAF QPS LRYRF P+NP K LN +SLSL+ Sbjct: 1 MQGVLQSKGLLSLPSNPRTRAFAPQPSQGLRYRFYPLNPSLKPGLLNGSSLSLN 54 >ref|XP_012856295.1| PREDICTED: plastidic ATP/ADP-transporter-like [Erythranthe guttatus] gi|604302010|gb|EYU21596.1| hypothetical protein MIMGU_mgv1a002865mg [Erythranthe guttata] Length = 629 Score = 62.4 bits (150), Expect = 2e-07 Identities = 36/56 (64%), Positives = 42/56 (75%), Gaps = 2/56 (3%) Frame = -2 Query: 168 MQAVLQSKGLLSLPSNPKTRA-FITQPSCDLRYRFN-PINPLSKSRTLNKASLSLS 7 MQ VLQSKGLLSLPSNP+TRA F+ P LRYR+N INP+ K LN +SLSL+ Sbjct: 1 MQGVLQSKGLLSLPSNPRTRASFLPPPLQGLRYRYNHVINPILKPGLLNASSLSLN 56 >emb|CDO98099.1| unnamed protein product [Coffea canephora] Length = 630 Score = 62.0 bits (149), Expect = 3e-07 Identities = 31/54 (57%), Positives = 41/54 (75%) Frame = -2 Query: 168 MQAVLQSKGLLSLPSNPKTRAFITQPSCDLRYRFNPINPLSKSRTLNKASLSLS 7 MQAV Q+KGLLSLPSNPKTRA + P LR+RF+P NPL K++ + S++L+ Sbjct: 1 MQAVFQTKGLLSLPSNPKTRALLNPPQQGLRHRFSPFNPL-KNKPFSGLSVNLN 53 >ref|XP_009624271.1| PREDICTED: plastidic ATP/ADP-transporter-like [Nicotiana tomentosiformis] Length = 631 Score = 60.1 bits (144), Expect = 1e-06 Identities = 34/54 (62%), Positives = 38/54 (70%) Frame = -2 Query: 168 MQAVLQSKGLLSLPSNPKTRAFITQPSCDLRYRFNPINPLSKSRTLNKASLSLS 7 M+AVLQ+KGLLSLPS PKTRAF P LR+RFN N L K + L SLSLS Sbjct: 1 MEAVLQTKGLLSLPSKPKTRAFYPLPQGGLRHRFNSFNSL-KPKPLEGLSLSLS 53 >ref|XP_009758418.1| PREDICTED: plastidic ATP/ADP-transporter-like [Nicotiana sylvestris] Length = 629 Score = 58.2 bits (139), Expect = 5e-06 Identities = 32/52 (61%), Positives = 37/52 (71%) Frame = -2 Query: 168 MQAVLQSKGLLSLPSNPKTRAFITQPSCDLRYRFNPINPLSKSRTLNKASLS 13 M+AVLQ+KGLLSLPS PKTRAF P LR+RFN +N L K + L SLS Sbjct: 1 MEAVLQTKGLLSLPSKPKTRAFYPLPQGGLRHRFNSVNSL-KPKPLEGLSLS 51